Castor canadensis (American beaver): 109690391 Help Entry 109690391         CDS       T04791                                  Symbol Tnf Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism ccan  Castor canadensis (American beaver) Pathway ccan01523   Antifolate resistance ccan04010   MAPK signaling pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04064   NF-kappa B signaling pathway ccan04071   Sphingolipid signaling pathway ccan04150   mTOR signaling pathway ccan04210   Apoptosis ccan04217   Necroptosis ccan04350   TGF-beta signaling pathway ccan04380   Osteoclast differentiation ccan04612   Antigen processing and presentation ccan04620   Toll-like receptor signaling pathway ccan04621   NOD-like receptor signaling pathway ccan04622   RIG-I-like receptor signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04640   Hematopoietic cell lineage ccan04650   Natural killer cell mediated cytotoxicity ccan04657   IL-17 signaling pathway ccan04660   T cell receptor signaling pathway ccan04664   Fc epsilon RI signaling pathway ccan04668   TNF signaling pathway ccan04920   Adipocytokine signaling pathway ccan04930   Type II diabetes mellitus ccan04931   Insulin resistance ccan04932   Non-alcoholic fatty liver disease ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04936   Alcoholic liver disease ccan04940   Type I diabetes mellitus ccan05010   Alzheimer disease ccan05014   Amyotrophic lateral sclerosis ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05132   Salmonella infection ccan05133   Pertussis ccan05134   Legionellosis ccan05135   Yersinia infection ccan05140   Leishmaniasis ccan05142   Chagas disease ccan05143   African trypanosomiasis ccan05144   Malaria ccan05145   Toxoplasmosis ccan05146   Amoebiasis ccan05152   Tuberculosis ccan05160   Hepatitis C ccan05161   Hepatitis B ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05165   Human papillomavirus infection ccan05166   Human T-cell leukemia virus 1 infection ccan05168   Herpes simplex virus 1 infection ccan05169   Epstein-Barr virus infection ccan05170   Human immunodeficiency virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05205   Proteoglycans in cancer ccan05310   Asthma ccan05321   Inflammatory bowel disease ccan05322   Systemic lupus erythematosus ccan05323   Rheumatoid arthritis ccan05330   Allograft rejection ccan05332   Graft-versus-host disease ccan05410   Hypertrophic cardiomyopathy ccan05414   Dilated cardiomyopathy ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109690391 (Tnf)    04350 TGF-beta signaling pathway     109690391 (Tnf)    04064 NF-kappa B signaling pathway     109690391 (Tnf)    04668 TNF signaling pathway     109690391 (Tnf)    04071 Sphingolipid signaling pathway     109690391 (Tnf)    04150 mTOR signaling pathway     109690391 (Tnf)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109690391 (Tnf)    04061 Viral protein interaction with cytokine and cytokine receptor     109690391 (Tnf)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109690391 (Tnf)    04217 Necroptosis     109690391 (Tnf)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109690391 (Tnf)    04620 Toll-like receptor signaling pathway     109690391 (Tnf)    04621 NOD-like receptor signaling pathway     109690391 (Tnf)    04622 RIG-I-like receptor signaling pathway     109690391 (Tnf)    04625 C-type lectin receptor signaling pathway     109690391 (Tnf)    04650 Natural killer cell mediated cytotoxicity     109690391 (Tnf)    04612 Antigen processing and presentation     109690391 (Tnf)    04660 T cell receptor signaling pathway     109690391 (Tnf)    04657 IL-17 signaling pathway     109690391 (Tnf)    04664 Fc epsilon RI signaling pathway     109690391 (Tnf)   09152 Endocrine system    04920 Adipocytokine signaling pathway     109690391 (Tnf)   09158 Development and regeneration    04380 Osteoclast differentiation     109690391 (Tnf)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     109690391 (Tnf)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109690391 (Tnf)    05170 Human immunodeficiency virus 1 infection     109690391 (Tnf)    05161 Hepatitis B     109690391 (Tnf)    05160 Hepatitis C     109690391 (Tnf)    05171 Coronavirus disease - COVID-19     109690391 (Tnf)    05164 Influenza A     109690391 (Tnf)    05168 Herpes simplex virus 1 infection     109690391 (Tnf)    05163 Human cytomegalovirus infection     109690391 (Tnf)    05169 Epstein-Barr virus infection     109690391 (Tnf)    05165 Human papillomavirus infection     109690391 (Tnf)   09171 Infectious disease: bacterial    05132 Salmonella infection     109690391 (Tnf)    05135 Yersinia infection     109690391 (Tnf)    05133 Pertussis     109690391 (Tnf)    05134 Legionellosis     109690391 (Tnf)    05152 Tuberculosis     109690391 (Tnf)   09174 Infectious disease: parasitic    05146 Amoebiasis     109690391 (Tnf)    05144 Malaria     109690391 (Tnf)    05145 Toxoplasmosis     109690391 (Tnf)    05140 Leishmaniasis     109690391 (Tnf)    05142 Chagas disease     109690391 (Tnf)    05143 African trypanosomiasis     109690391 (Tnf)   09163 Immune disease    05310 Asthma     109690391 (Tnf)    05322 Systemic lupus erythematosus     109690391 (Tnf)    05323 Rheumatoid arthritis     109690391 (Tnf)    05321 Inflammatory bowel disease     109690391 (Tnf)    05330 Allograft rejection     109690391 (Tnf)    05332 Graft-versus-host disease     109690391 (Tnf)   09164 Neurodegenerative disease    05010 Alzheimer disease     109690391 (Tnf)    05014 Amyotrophic lateral sclerosis     109690391 (Tnf)    05020 Prion disease     109690391 (Tnf)    05022 Pathways of neurodegeneration - multiple diseases     109690391 (Tnf)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109690391 (Tnf)    05418 Fluid shear stress and atherosclerosis     109690391 (Tnf)    05410 Hypertrophic cardiomyopathy     109690391 (Tnf)    05414 Dilated cardiomyopathy     109690391 (Tnf)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     109690391 (Tnf)    04940 Type I diabetes mellitus     109690391 (Tnf)    04936 Alcoholic liver disease     109690391 (Tnf)    04932 Non-alcoholic fatty liver disease     109690391 (Tnf)    04931 Insulin resistance     109690391 (Tnf)    04933 AGE-RAGE signaling pathway in diabetic complications     109690391 (Tnf)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     109690391 (Tnf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109690391 (Tnf)    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109690391 (Tnf) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Tumor necrosis fators    109690391 (Tnf) Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Cytokines    109690391 (Tnf) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF DUF956 Motif Other DBs NCBI-GeneID:  109690391 NCBI-ProteinID:  XP_020025284 UniProt:  A0A8B7V296 LinkDB All DBs Position Unknown AA seq 234 aa AA seqDB search MSTESMIQDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EEFGNSLPFNSHLAQTLTLRSSSQNASDKPVAHVVANHQVEEQLQWLSRRANALLANGME LIDNQLVVPADGLYLIYSQVLFKGQGCPSYVLLTHTVSRFAVSYRENVNLLSAIKSPCQK ETPEGAELKPWYEPIYLGGVFQLEKGDRLSAEVNLPSYLDFAESGQVYFGVIAL NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccaggacgtggaactggcagaggaggcactccccaagaag gcggggggcccccagggctccagacggtgcttgtgcctcagcctcttctccttcctgctt gtggcaggagccaccacgcttttctgcctgcttcacttcggggtgatcggcccccagagg gaagagttcgggaatagccttcctttcaacagccacctggcccagaccctcacactcaga tcatcatcgcaaaatgcaagtgacaagcctgtagcccatgttgtagcaaaccaccaagtg gaggagcagctgcagtggctgagccggcgtgccaatgctctccttgcaaatggcatggag ctgatagacaaccagctggttgtgccagcagacggactgtacctcatctactcccaggtc cttttcaaaggccaaggctgtccctcctatgtacttctcacccatacagtgagccgcttc gccgtctcctatcgggaaaacgttaacctcctctctgccatcaagagcccctgccagaag gagaccccagagggggctgagctcaagccctggtatgagcccatctacctggggggggtc ttccagctggagaagggtgaccgactcagtgcggaagtcaatctgcccagctatctagac tttgctgagtctgggcaggtctactttggggtcattgctctgtga

DBGET integrated database retrieval system