Castor canadensis (American beaver): 109691135 Help Entry 109691135         CDS       T04791                                  Symbol Max Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism ccan  Castor canadensis (American beaver) Pathway ccan03083   Polycomb repressive complex ccan04010   MAPK signaling pathway ccan05200   Pathways in cancer ccan05202   Transcriptional misregulation in cancer ccan05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     109691135 (Max)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109691135 (Max)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109691135 (Max)    05202 Transcriptional misregulation in cancer     109691135 (Max)   09162 Cancer: specific types    05222 Small cell lung cancer     109691135 (Max)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccan03000]     109691135 (Max)    03036 Chromosome and associated proteins [BR:ccan03036]     109691135 (Max) Transcription factors [BR:ccan03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     109691135 (Max) Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      109691135 (Max) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH bZIP_2 Filament bHLH_INO4 SlyX JetA bHLH_INO2 SLX9 GAGA_bind DUF7801 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  109691135 NCBI-ProteinID:  XP_020026510 UniProt:  A0A8C0WEK8 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN NLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgaagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccgtcgctccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacacg caccagcaagatatcgatgacctcaagcggcagaacgctcttctggagcagcaagtccgt gcactggagaaggcaaggtcgagtgcccagctgcagaccaactacccctcctcagacaac aacctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcagactcc agctcagagtcagagcctgaagagccccaaagcaggaagaaactccggatggaggccagc taa

DBGET integrated database retrieval system