Castor canadensis (American beaver): 109694000 Help Entry 109694000         CDS       T04791                                  Symbol Fos Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism ccan  Castor canadensis (American beaver) Pathway ccan01522   Endocrine resistance ccan04010   MAPK signaling pathway ccan04024   cAMP signaling pathway ccan04210   Apoptosis ccan04380   Osteoclast differentiation ccan04620   Toll-like receptor signaling pathway ccan04657   IL-17 signaling pathway ccan04658   Th1 and Th2 cell differentiation ccan04659   Th17 cell differentiation ccan04660   T cell receptor signaling pathway ccan04662   B cell receptor signaling pathway ccan04668   TNF signaling pathway ccan04713   Circadian entrainment ccan04725   Cholinergic synapse ccan04728   Dopaminergic synapse ccan04915   Estrogen signaling pathway ccan04917   Prolactin signaling pathway ccan04921   Oxytocin signaling pathway ccan04926   Relaxin signaling pathway ccan04928   Parathyroid hormone synthesis, secretion and action ccan04932   Non-alcoholic fatty liver disease ccan04935   Growth hormone synthesis, secretion and action ccan05031   Amphetamine addiction ccan05132   Salmonella infection ccan05133   Pertussis ccan05135   Yersinia infection ccan05140   Leishmaniasis ccan05142   Chagas disease ccan05161   Hepatitis B ccan05162   Measles ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05170   Human immunodeficiency virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05207   Chemical carcinogenesis - receptor activation ccan05208   Chemical carcinogenesis - reactive oxygen species ccan05210   Colorectal cancer ccan05224   Breast cancer ccan05231   Choline metabolism in cancer ccan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccan05323   Rheumatoid arthritis ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109694000 (Fos)    04668 TNF signaling pathway     109694000 (Fos)    04024 cAMP signaling pathway     109694000 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109694000 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109694000 (Fos)    04660 T cell receptor signaling pathway     109694000 (Fos)    04658 Th1 and Th2 cell differentiation     109694000 (Fos)    04659 Th17 cell differentiation     109694000 (Fos)    04657 IL-17 signaling pathway     109694000 (Fos)    04662 B cell receptor signaling pathway     109694000 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     109694000 (Fos)    04917 Prolactin signaling pathway     109694000 (Fos)    04921 Oxytocin signaling pathway     109694000 (Fos)    04926 Relaxin signaling pathway     109694000 (Fos)    04935 Growth hormone synthesis, secretion and action     109694000 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     109694000 (Fos)   09156 Nervous system    04725 Cholinergic synapse     109694000 (Fos)    04728 Dopaminergic synapse     109694000 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     109694000 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     109694000 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109694000 (Fos)    05207 Chemical carcinogenesis - receptor activation     109694000 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     109694000 (Fos)    05231 Choline metabolism in cancer     109694000 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109694000 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     109694000 (Fos)    05224 Breast cancer     109694000 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109694000 (Fos)    05170 Human immunodeficiency virus 1 infection     109694000 (Fos)    05161 Hepatitis B     109694000 (Fos)    05171 Coronavirus disease - COVID-19     109694000 (Fos)    05162 Measles     109694000 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     109694000 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     109694000 (Fos)    05135 Yersinia infection     109694000 (Fos)    05133 Pertussis     109694000 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109694000 (Fos)    05142 Chagas disease     109694000 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     109694000 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     109694000 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109694000 (Fos)    05418 Fluid shear stress and atherosclerosis     109694000 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109694000 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     109694000 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccan03000]     109694000 (Fos)    04131 Membrane trafficking [BR:ccan04131]     109694000 (Fos) Transcription factors [BR:ccan03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     109694000 (Fos) Membrane trafficking [BR:ccan04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     109694000 (Fos) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  109694000 NCBI-ProteinID:  XP_020031227 UniProt:  A0A250YGS4 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRTGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccattcacccgccgactccttctccagcatg gggtctcccgtcaatgcgcaggacttctgcacggatctgtctgtctccagtgccaacttc attcccacggtgactgctatctccaccagcccggatctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcgcagaccagagccccccacccatacggagttcccacc ccctcggctggggcttactccaggactggagtggtgaagaccatgacaggaggcagagca cagagcatcggcaggaggggcaaagtagaacagttatctcctgaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccgaaaccggaggagggag ctcacggatactctccaagcggagacagaccaacttgaagacgagaagtctgctttgcag actgagattgccaacctgctgaaggagaaggaaaaactggagttcatcctggcagctcac cgacctgcctgcaagatccccgatgacctgggcttcccagaagagatgtcggtggcatcc ctggatttgagtgggggcctgccagaggctgccaccccagagtctgaggaggccttcacc ctgccccttctcaatgatcctgagcccaagccatcggtggagcccgtcaaaagcatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccggcatcatccaggccc agtggctctgagaccgcccgctctgtgccagacatggacttgtctggttccttctatgca gcagactgggagcccctgcatagtggctccctggggatggggcccatggccacagagttg gagcccctgtgcacccctgtggttacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctatcccgaggctgactccttccccagctgcgcagctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcactcagctcacccacactgctggccctg tga

DBGET integrated database retrieval system