Castor canadensis (American beaver): 109697786 Help Entry 109697786         CDS       T04791                                  Symbol Nppa Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism ccan  Castor canadensis (American beaver) Pathway ccan04022   cGMP-PKG signaling pathway ccan04024   cAMP signaling pathway ccan04066   HIF-1 signaling pathway ccan04081   Hormone signaling ccan04270   Vascular smooth muscle contraction ccan04714   Thermogenesis ccan04921   Oxytocin signaling pathway ccan04923   Regulation of lipolysis in adipocytes ccan04924   Renin secretion ccan04925   Aldosterone synthesis and secretion ccan05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     109697786 (Nppa)    04024 cAMP signaling pathway     109697786 (Nppa)    04022 cGMP-PKG signaling pathway     109697786 (Nppa)   09133 Signaling molecules and interaction    04081 Hormone signaling     109697786 (Nppa)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     109697786 (Nppa)    04921 Oxytocin signaling pathway     109697786 (Nppa)    04924 Renin secretion     109697786 (Nppa)    04925 Aldosterone synthesis and secretion     109697786 (Nppa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     109697786 (Nppa)   09159 Environmental adaptation    04714 Thermogenesis     109697786 (Nppa)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     109697786 (Nppa)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109697786 (Nppa) Cytokines and neuropeptides [BR:ccan04052]  Neuropeptides   Unclassified    109697786 (Nppa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  109697786 NCBI-ProteinID:  XP_020037226 UniProt:  A0A8B7VZ75 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MGSFSITMSLLLFLAFQLPDQTGANPVSNADLMDFKNLLDHLEEKMPFGDEAVAPQVLSE QNDEVGAALSSLPEMPPWTGEVSPSQRDGGALGRSPWDSSDRSTLLKSKLRALLTAPRSL RRSSCFGGRIDRIGAQSGLGCNSFRYRR NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgggctccttctccatcaccatgagcctcctcctcttcctggcctttcagcttccagac caaactggagccaatcctgtgtccaatgcagacctgatggatttcaagaatttgctggac catttggaggagaagatgccttttggagacgaggctgtggccccacaagtcctaagcgag cagaatgatgaagtgggggcagctctcagctccctccctgagatgcctccctggactggg gaggtcagcccatctcagagagatgggggtgcccttgggaggagcccctgggactcctcc gatcgatctaccctcctaaagagcaaactgagggcattgctcactgcccctcggagcctg aggaggtccagctgctttgggggcaggattgacaggatcggggcccagagtggactgggc tgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system