Castor canadensis (American beaver): 109699305 Help Entry 109699305         CDS       T04791                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism ccan  Castor canadensis (American beaver) Pathway ccan04010   MAPK signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04024   cAMP signaling pathway ccan04062   Chemokine signaling pathway ccan04510   Focal adhesion ccan04520   Adherens junction ccan04611   Platelet activation ccan04670   Leukocyte transendothelial migration ccan04720   Long-term potentiation ccan04722   Neurotrophin signaling pathway ccan04934   Cushing syndrome ccan04972   Pancreatic secretion ccan05211   Renal cell carcinoma ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109699305    04014 Ras signaling pathway     109699305    04015 Rap1 signaling pathway     109699305    04024 cAMP signaling pathway     109699305  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     109699305    04520 Adherens junction     109699305  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109699305    04670 Leukocyte transendothelial migration     109699305    04062 Chemokine signaling pathway     109699305   09154 Digestive system    04972 Pancreatic secretion     109699305   09156 Nervous system    04720 Long-term potentiation     109699305    04722 Neurotrophin signaling pathway     109699305  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     109699305   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109699305   09167 Endocrine and metabolic disease    04934 Cushing syndrome     109699305  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109699305    04031 GTP-binding proteins [BR:ccan04031]     109699305 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109699305   Exosomal proteins of other body fluids (saliva and urine)    109699305   Exosomal proteins of colorectal cancer cells    109699305 GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     109699305 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  109699305 NCBI-ProteinID:  XP_020039536 UniProt:  A0A250YBJ4 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggtgttggaaaatctgctctgact gtacagtttgtccaaggaatttttgttgaaaaatatgatcctacaatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaattttggatactgcagga acggaacaatttacagcaatgagagatttgtacatgaaaaatggacaaggctttgcttta gtttattccatcacagcacagtctacatttaatgatttacaagatctaagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacaggaaaactccagtgcctgggaaggcccgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system