Castor canadensis (American beaver): 109699439 Help Entry 109699439         CDS       T04791                                  Symbol Il18 Name (RefSeq) interleukin-18 isoform X1   KO K05482   interleukin 18 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04621   NOD-like receptor signaling pathway ccan04623   Cytosolic DNA-sensing pathway ccan05132   Salmonella infection ccan05134   Legionellosis ccan05135   Yersinia infection ccan05143   African trypanosomiasis ccan05144   Malaria ccan05152   Tuberculosis ccan05164   Influenza A ccan05321   Inflammatory bowel disease ccan05323   Rheumatoid arthritis ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109699439 (Il18)    04061 Viral protein interaction with cytokine and cytokine receptor     109699439 (Il18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109699439 (Il18)    04623 Cytosolic DNA-sensing pathway     109699439 (Il18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     109699439 (Il18)   09171 Infectious disease: bacterial    05132 Salmonella infection     109699439 (Il18)    05135 Yersinia infection     109699439 (Il18)    05134 Legionellosis     109699439 (Il18)    05152 Tuberculosis     109699439 (Il18)   09174 Infectious disease: parasitic    05144 Malaria     109699439 (Il18)    05143 African trypanosomiasis     109699439 (Il18)   09163 Immune disease    05323 Rheumatoid arthritis     109699439 (Il18)    05321 Inflammatory bowel disease     109699439 (Il18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109699439 (Il18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109699439 (Il18) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interleukins    109699439 (Il18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 Motif Other DBs NCBI-GeneID:  109699439 NCBI-ProteinID:  XP_020039709 UniProt:  A0A8B7W7D0 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MMAAALADDTCINFVGMKFIDNTLYFIAESDEDLESDYFGKLDSKYAIIRNLNDQILFVD HRKPPVFEDMSDSDCRDNETQTRLIIHMYKDSLARGMAVTISVNCNKMSTLSCKDTTISF KEIPLPEDIPDTKSDIIFFQRSVPGHHNKMQFESSLYEGHFLACKKANDVFKLVLKKKDD YGDKSIMFIVQSEI NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgatggctgctgcacttgcagatgacacttgcatcaattttgtggggatgaaattcatt gacaatacgctgtactttatagctgaaagtgatgaagacctggaatcggattactttggc aagcttgactctaagtatgcaatcatacgaaatctgaatgaccaaattctcttcgttgac cacagaaaaccacctgtgtttgaagatatgtccgattctgactgtagagataatgaaacc cagaccagattaataatacatatgtataaagatagcctcgctagaggtatggctgtaacc atctctgtgaactgtaataaaatgtctactctctcctgtaaggacacaactatttccttt aaggaaatccctcttcctgaagacattcctgatacaaaaagtgacatcatattctttcag agaagtgttccaggacatcacaataagatgcaatttgaatcttcattgtatgaaggacac tttctagcttgtaaaaaagcaaatgatgttttcaaacttgttttgaaaaaaaaggatgac tacggtgataagtctataatgttcattgttcagagtgagatctaa

DBGET integrated database retrieval system