Cyprinus carpio (common carp): 109050099 Help Entry 109050099         CDS       T05134                                  Name (RefSeq) apoptosis regulator Bcl-2-like   KO K02161   apoptosis regulator Bcl-2 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04115   p53 signaling pathway ccar04140   Autophagy - animal ccar04141   Protein processing in endoplasmic reticulum ccar04210   Apoptosis ccar04217   Necroptosis ccar04261   Adrenergic signaling in cardiomyocytes ccar04340   Hedgehog signaling pathway ccar04510   Focal adhesion ccar04621   NOD-like receptor signaling pathway ccar05132   Salmonella infection ccar05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109050099  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     109050099  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109050099   09143 Cell growth and death    04210 Apoptosis     109050099    04217 Necroptosis     109050099    04115 p53 signaling pathway     109050099   09144 Cellular community - eukaryotes    04510 Focal adhesion     109050099  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109050099   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109050099  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     109050099   09171 Infectious disease: bacterial    05132 Salmonella infection     109050099  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccar01009]     109050099 Protein phosphatases and associated proteins [BR:ccar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      109050099 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Cep57_MT_bd Motif Other DBs NCBI-GeneID:  109050099 NCBI-ProteinID:  XP_042625838 UniProt:  A0A9R0B8E8 LinkDB All DBs Position A2:complement(4671930..4707750) Genome browser AA seq 207 aa AA seqDB search MAQENVYDNRSIVEKYIHHKLWKKGYVWEVNGHDDRVSNGLMMGRQEDRGGTRHDPCSAL HKVLREAGDELERLYQSDFAEMSKQLHLTSITAQQRFTAVIDELFRDGVNWGRIIAFFEF GGTVCVECVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGWEAFVELYGRQRDSVFRSS WSSIVTVFGLAALGAVGLTIGAYLAQK NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcacaggagaatgtgtatgataaccgcagtatagtggagaagtacatccaccataag ctctggaagaaggggtacgtgtgggaagtgaacggacacgatgaccgcgtctcgaatgga ctgatgatggggaggcaggaggaccgcggcggcacccgtcacgacccgtgcagcgcgctt cataaggtgctgcgggaggccggggacgagctggagcggctttatcagtcggactttgcg gagatgtccaaacagctgcatctcacgtccatcacggcgcagcagcgctttaccgcggtc atagacgagctgttcagggacggcgtgaactggggcagaatcatcgcttttttcgagttt ggagggaccgtttgtgtcgaatgcgtgaataaggagatgacggcgcatgtggataacatc gcgggctggatgaccgagtatctgaatgggccgctgcacgcctggatccaggagaacggc ggctgggaggcgtttgtggagctctacggcaggcagagggactcggtgtttcgcagctcg tggtcatcaatagtaacggtcttcggtctagccgctctcggggctgttggcttgaccata ggagcctaccttgctcagaaatga

DBGET integrated database retrieval system