Cyprinus carpio (common carp): 109051058 Help Entry 109051058         CDS       T05134                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism ccar  Cyprinus carpio (common carp) Pathway ccar00510   N-Glycan biosynthesis ccar00513   Various types of N-glycan biosynthesis ccar04141   Protein processing in endoplasmic reticulum Module ccar_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ccar00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109051058    00513 Various types of N-glycan biosynthesis     109051058  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109051058 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  109051058 NCBI-ProteinID:  XP_018924131 Ensembl:  ENSCCRG00000014714 UniProt:  A0A8C1K9A0 LinkDB All DBs Position A25:complement(2672837..2675262) Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLMAIGMFFTAWFFVYEVTSTKYTRDLYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgacgagatacaccagtccggtgaacccggccgtgtttcctcac ctcaccgtggtgctgatggccatcggcatgttcttcaccgcctggttctttgtatatgaa gtgacgtccacgaagtacacgcgagatctgtacaaagagctgctgatttctctggtggct tcgctcttcatgggcttcggcgttctgttcctcttactgtgggtcggcatttatgtctga

DBGET integrated database retrieval system