Cyprinus carpio (common carp): 122138158 Help Entry 122138158         CDS       T05134                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ccar  Cyprinus carpio (common carp) Pathway ccar03420   Nucleotide excision repair ccar04110   Cell cycle ccar04114   Oocyte meiosis ccar04120   Ubiquitin mediated proteolysis ccar04141   Protein processing in endoplasmic reticulum ccar04310   Wnt signaling pathway ccar04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122138158    04120 Ubiquitin mediated proteolysis     122138158   09124 Replication and repair    03420 Nucleotide excision repair     122138158  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     122138158    04350 TGF-beta signaling pathway     122138158  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     122138158    04114 Oocyte meiosis     122138158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccar04121]     122138158    03400 DNA repair and recombination proteins [BR:ccar03400]     122138158 Enzymes [BR:ccar01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122138158 Ubiquitin system [BR:ccar04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122138158   Multi subunit type E3    SCF complex     Ring finger protein      122138158    Cul2 complex      122138158    Cul3 complex      122138158    Cul4 complex      122138158    Cul7 complex      122138158    Cul8 complex      122138158    Cul9 complex      122138158 DNA repair and recombination proteins [BR:ccar03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122138158     TCR (transcription coupled repair) factors      Cul4-CSA complex       122138158 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  122138158 NCBI-ProteinID:  XP_042585040 UniProt:  A0A9R1SN64 LinkDB All DBs Position A3:complement(30130014..30132446) Genome browser AA seq 124 aa AA seqDB search MRSHSLTHSREITLANMAAAMDVDTPGGANSGASKKRFEVKKWNAVALWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQ KYGH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgcgatctcactccctcactcactctcgcgagatcacattagcaaacatggcggccgcg atggatgtagacacccccggtggagctaacagtggagccagtaaaaaacgtttcgaagtg aaaaagtggaatgctgtggctctgtgggcttgggacattgtggtggacaactgtgccatt tgcaggaatcacattatggacctctgtatagagtgtcaggccaatcaggcgtcggctaca tcagaggagtgtacagtggcctggggagtctgtaatcatgcgtttcacttccactgcatc tctcgctggctgaagaccagacaggtgtgtcctctggacaacagagagtgggagttccag aagtacggccattag

DBGET integrated database retrieval system