Caretta caretta (Loggerhead turtle): 125629578 Help Entry 125629578         CDS       T09292                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay03420   Nucleotide excision repair ccay04110   Cell cycle ccay04114   Oocyte meiosis ccay04120   Ubiquitin mediated proteolysis ccay04141   Protein processing in endoplasmic reticulum ccay04310   Wnt signaling pathway ccay04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ccay00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125629578 (RBX1)    04120 Ubiquitin mediated proteolysis     125629578 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     125629578 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     125629578 (RBX1)    04350 TGF-beta signaling pathway     125629578 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     125629578 (RBX1)    04114 Oocyte meiosis     125629578 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccay04121]     125629578 (RBX1)    03400 DNA repair and recombination proteins [BR:ccay03400]     125629578 (RBX1) Enzymes [BR:ccay01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      125629578 (RBX1) Ubiquitin system [BR:ccay04121]  Ubiquitin ligases (E3)   UBL E3 ligases    125629578 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      125629578 (RBX1)    Cul2 complex      125629578 (RBX1)    Cul3 complex      125629578 (RBX1)    Cul4 complex      125629578 (RBX1)    Cul7 complex      125629578 (RBX1)    Cul8 complex      125629578 (RBX1)    Cul9 complex      125629578 (RBX1) DNA repair and recombination proteins [BR:ccay03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       125629578 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       125629578 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  125629578 NCBI-ProteinID:  XP_048690901 LinkDB All DBs Position 1:254457895..254471861 Genome browser AA seq 120 aa AA seqDB search MRNKGTWNRVFKMAAAMDVDTPSGTNSSASKKRFEVKKWNAVALWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgcgcaataaggggacctggaatcgtgtattcaaaatggcggcggcgatggatgtggac accccgagcggcaccaacagtagcgccagtaagaagcgcttcgaagtgaagaagtggaat gcagtagctctctgggcctgggacattgtggttgataactgtgccatttgcaggaaccat atcatggatctgtgtatagaatgtcaagctaaccaggcatcggctacctctgaagagtgt actgtcgcatggggtgtctgcaatcatgctttccacttccactgcatctctcgttggctt aagactcgccaggtgtgtccactggacaacagagaatgggagttccaaaagtatgggcac taa

DBGET integrated database retrieval system