Caretta caretta (Loggerhead turtle): 125631072 Help Entry 125631072         CDS       T09292                                  Name (RefSeq) actin, muscle   KO K05692   actin beta/gamma 1 Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay03082   ATP-dependent chromatin remodeling ccay04145   Phagosome ccay04210   Apoptosis ccay04510   Focal adhesion ccay04520   Adherens junction ccay04530   Tight junction ccay04810   Regulation of actin cytoskeleton ccay04814   Motor proteins ccay04820   Cytoskeleton in muscle cells ccay05100   Bacterial invasion of epithelial cells ccay05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccay00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125631072  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     125631072   09143 Cell growth and death    04210 Apoptosis     125631072   09144 Cellular community - eukaryotes    04510 Focal adhesion     125631072    04520 Adherens junction     125631072    04530 Tight junction     125631072   09142 Cell motility    04814 Motor proteins     125631072    04820 Cytoskeleton in muscle cells     125631072    04810 Regulation of actin cytoskeleton     125631072  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125631072    05100 Bacterial invasion of epithelial cells     125631072  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ccay03021]     125631072    03019 Messenger RNA biogenesis [BR:ccay03019]     125631072    03036 Chromosome and associated proteins [BR:ccay03036]     125631072    03029 Mitochondrial biogenesis [BR:ccay03029]     125631072   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccay04812]     125631072    04147 Exosome [BR:ccay04147]     125631072 Transcription machinery [BR:ccay03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      125631072 Messenger RNA biogenesis [BR:ccay03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      125631072 Chromosome and associated proteins [BR:ccay03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      125631072     NuA4 complex      125631072   Chromatin remodeling factors    BAF complex     125631072    PBAF complex     125631072    GBAF(ncBAF) complex     125631072    SWR1 complex     125631072 Mitochondrial biogenesis [BR:ccay03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     125631072 Cytoskeleton proteins [BR:ccay04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      125631072 Exosome [BR:ccay04147]  Exosomal proteins   Proteins found in most exosomes    125631072 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  125631072 NCBI-ProteinID:  XP_048693205 LinkDB All DBs Position 2:237720572..237722250 Genome browser AA seq 246 aa AA seqDB search MNQFEQSGTLHRISATVRNRTNTYFPPVSRILPASQYQGYALPHTILCPDLAGRDLTDYL MKILTERGYSLTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYKLPDGQVIT IGNERFRCPEAFFQPSFLGMESCGIPETTFNSIMKCDVDIQKDLYSNTVLSGGTTMYPGI ADRMQKDITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSM VHRKCF NT seq 741 nt NT seq  +upstreamnt  +downstreamnt atgaaccagtttgagcagagtggcacactgcacagaatttccgcaacagttcgaaacaga acaaacacatactttcctccagtgtccaggatcctacctgcctctcaataccaaggttac gctctgccccacaccatcctgtgtccggacttagctggccgagacctgacagactacctc atgaagattctgacagaaagaggctacagcctcaccacaacagctgaaagggaaattgta cgtgacataaaggaaaagctgtgctacgttgcactggatttcgaacaggagatggccact gctgcttcatcttcctccctggagaaaagctacaaactgcctgatggtcaggtgatcacc attggcaatgagaggttcaggtgtccagaggccttcttccagccatctttcctgggtatg gaatcctgtggcattcctgagaccactttcaactctatcatgaagtgcgatgtagatatt caaaaggacctgtattccaacacagtattgtctgggggtaccacaatgtaccctggaatt gctgacagaatgcaaaaggacatcacagctctggcacccagtacaatgaaaattaagatt attgctccacctgaacgtaaatactctgtctggattggtggttccatcctggcttccctc tctaccttccagcagatgtggatcagcaagcaggaatatgatgagtctggcccatccatg gtccaccgtaaatgcttctaa

DBGET integrated database retrieval system