Coregonus clupeaformis (lake whitefish): 121553219 Help Entry 121553219         CDS       T08357                                  Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04060   Cytokine-cytokine receptor interaction cclu04672   Intestinal immune network for IgA production cclu04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121553219  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121553219  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     121553219  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cclu04052]     121553219    00536 Glycosaminoglycan binding proteins [BR:cclu00536]     121553219 Cytokines and neuropeptides [BR:cclu04052]  Cytokines   Chemokines    121553219 Glycosaminoglycan binding proteins [BR:cclu00536]  Heparan sulfate / Heparin   Chemokines    121553219 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  121553219 NCBI-ProteinID:  XP_041722161 LinkDB All DBs Position 27:complement(51749298..51793191) Genome browser AA seq 98 aa AA seqDB search MDLKLLAVMSVLAVATYAPFSQAKPFSMIERCWCRSTVNTVPQRNIRELKFLHTPNCPFQ VIAKLKNHKEVCINPETKWLQQYLKNALNKMKKAKQTN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggatttgaaactcttggcggttatgtctgtgcttgctgtggcgacatacgctcctttc tcacaagctaagcccttcagtatgatcgagaggtgctggtgtcgttctacagttaacacc gtcccccagcgcaacatcagagaactgaagttcctacacacacccaactgccccttccaa gtgattgccaagctgaagaaccacaaggaggtgtgtatcaaccccgagaccaagtggctg cagcagtacctgaagaatgccctcaacaagatgaagaaagccaagcagaccaactag

DBGET integrated database retrieval system