Coregonus clupeaformis (lake whitefish): 121553840 Help Entry 121553840         CDS       T08357                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism cclu  Coregonus clupeaformis (lake whitefish) Pathway cclu04010   MAPK signaling pathway cclu04510   Focal adhesion cclu04517   IgSF CAM signaling cclu04520   Adherens junction Brite KEGG Orthology (KO) [BR:cclu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121553840   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121553840  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     121553840    04520 Adherens junction     121553840  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cclu04147]     121553840    04031 GTP-binding proteins [BR:cclu04031]     121553840 Exosome [BR:cclu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121553840   Exosomal proteins of other body fluids (saliva and urine)    121553840   Exosomal proteins of colorectal cancer cells    121553840 GTP-binding proteins [BR:cclu04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     121553840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 Motif Other DBs NCBI-GeneID:  121553840 NCBI-ProteinID:  XP_045077465 LinkDB All DBs Position 7:72662331..72694921 Genome browser AA seq 169 aa AA seqDB search LSLQTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNG QGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLA RQWSSCAFLESSAKSKINVNEIFYDLVRQINRKTPAPGKARKKSNCRLL NT seq 510 nt NT seq  +upstreamnt  +downstreamnt ttgtctctacagaccgtacagtttgttcaggggattttcgtggagaaatatgacccgaca atagaagactcgtacagaaagcaagtggaggtggacgggcagcagtgtatgctggagatt ctggacactgcagggacggaacaatttacagccatgagagatctgtacatgaagaacggc cagggctttgccttagtatactccatcacagcccagtccacgttcaacgatctgcaagac ctacgagaacagatcctccgagtcaaagacactgacgatgttccgatgattctggtgggt aataaatgtgatctggaggatgagcgtgttgtggggaaggaacagggacagaacctggcc agacagtggagcagctgtgcattcctggagtcctccgcaaagtccaagatcaacgtcaac gagatcttctatgacctggtcaggcaaatcaacaggaaaaccccagcgccaggcaaggca cgcaaaaagtccaactgtcggctcctctaa

DBGET integrated database retrieval system