Cyphomyrmex costatus: 108778032 Help Entry 108778032         CDS       T11118                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ccoa  Cyphomyrmex costatus Pathway ccoa00510   N-Glycan biosynthesis ccoa00513   Various types of N-glycan biosynthesis ccoa04141   Protein processing in endoplasmic reticulum Module ccoa_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ccoa00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     108778032    00513 Various types of N-glycan biosynthesis     108778032  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108778032 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 TctB CAAD Pestivirus_E2 Motif Other DBs NCBI-GeneID:  108778032 NCBI-ProteinID:  XP_018400593 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MVEIESMMRYVSPVNPAVFPLLAVVLLGIGIFFTAWFFVYEVTSTKFTRDIFKEALISLV AALFSSFGVLFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggaaatcgagtcaatgatgagatatgtctcgccggtgaacccagctgtttttcct ctgttggctgtggtgctattaggaattggaatatttttcacggcctggttcttcgtgtat gaggttaccagcacgaaattcacacgagatatattcaaggaagcactaatttcattggtc gcagcgttattctctagctttggagtactatttctattgctttgggttggaatttatgta taa

DBGET integrated database retrieval system