Colias croceus (clouded yellow): 123692168 Help Entry 123692168         CDS       T08651                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ccrc  Colias croceus (clouded yellow) Pathway ccrc03420   Nucleotide excision repair ccrc04120   Ubiquitin mediated proteolysis ccrc04141   Protein processing in endoplasmic reticulum ccrc04310   Wnt signaling pathway ccrc04341   Hedgehog signaling pathway - fly ccrc04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ccrc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123692168    04120 Ubiquitin mediated proteolysis     123692168   09124 Replication and repair    03420 Nucleotide excision repair     123692168  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     123692168    04341 Hedgehog signaling pathway - fly     123692168    04350 TGF-beta signaling pathway     123692168  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccrc04121]     123692168    03400 DNA repair and recombination proteins [BR:ccrc03400]     123692168 Enzymes [BR:ccrc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      123692168 Ubiquitin system [BR:ccrc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    123692168   Multi subunit type E3    SCF complex     Ring finger protein      123692168    Cul2 complex      123692168    Cul3 complex      123692168    Cul4 complex      123692168    Cul7 complex      123692168    Cul8 complex      123692168    Cul9 complex      123692168 DNA repair and recombination proteins [BR:ccrc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       123692168     TCR (transcription coupled repair) factors      Cul4-CSA complex       123692168 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  123692168 NCBI-ProteinID:  XP_045492822 LinkDB All DBs Position 5:7615898..7618302 Genome browser AA seq 113 aa AA seqDB search MASAMDVDEEEVEMASSSSGKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcatcggcaatggatgtcgacgaagaggaagtcgaaatggcgtcttccagcagtggt aaaggagataaaaaaagattcgaagtgaaaaagtggaatgctgtcgctctgtgggcctgg gatattgtggtggacaactgcgctatttgccgcaaccatataatggatctttgcatagag tgtcaggcaaaccaggcatctgcaaccagtgaagaatgtacagttgcttggggagtgtgt aatcatgcattccattttcactgcatctctcgttggctcaaaacgagacaagtttgccca ttagacaacagagaatgggagttccaaaagtatggccattaa

DBGET integrated database retrieval system