Cariama cristata (Red-legged seriema): 104156530 Help Entry 104156530         CDS       T08341                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri00670   One carbon pool by folate ccri00790   Folate biosynthesis ccri01100   Metabolic pathways ccri01240   Biosynthesis of cofactors ccri04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:ccri00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104156530 (DHFR)    00670 One carbon pool by folate     104156530 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104156530 (DHFR) Enzymes [BR:ccri01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104156530 (DHFR) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  104156530 NCBI-ProteinID:  XP_009701458 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTSTSHVEGKQNALIMGKKTWFSIPEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFMTRILQEFESDTFFPEIDYKDY KLLTEYPGVPADIQEENGIQYKFEVYEKAVLAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgactagcacatcccatgtggaaggtaaacagaatgcactgataatgggtaaaaaaacg tggttctccattcctgagaagaatcgtcctttaaaagacaggattaatatagtgctcagc agggagctcaaggaagccccaaaaggagcacattacctttccaaaagtctggatgatgcc ttagctcttttggattcaccagagttaaaaagtaaagtagacatggtttggatcgtcgga ggcacttcagtttacaaggcagcaatggagaagccaattaatcatcgattgttcatgaca agaattttgcaggaatttgaaagtgacacattttttccagaaatcgactataaggactac aaacttctcacagagtacccaggtgtccctgctgatatccaagaagagaatggcatccag tacaaatttgaagtgtatgaaaaagctgtcttggcacaataa

DBGET integrated database retrieval system