Crocuta crocuta (spotted hyena): 144235367 Help Entry 144235367         CDS       T11532                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04060   Cytokine-cytokine receptor interaction ccru04151   PI3K-Akt signaling pathway ccru04630   JAK-STAT signaling pathway ccru04640   Hematopoietic cell lineage ccru04657   IL-17 signaling pathway ccru04658   Th1 and Th2 cell differentiation ccru04659   Th17 cell differentiation ccru04660   T cell receptor signaling pathway ccru04664   Fc epsilon RI signaling pathway ccru04672   Intestinal immune network for IgA production ccru05140   Leishmaniasis ccru05200   Pathways in cancer ccru05310   Asthma ccru05320   Autoimmune thyroid disease ccru05321   Inflammatory bowel disease ccru05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     144235367 (IL4)    04151 PI3K-Akt signaling pathway     144235367 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     144235367 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     144235367 (IL4)    04660 T cell receptor signaling pathway     144235367 (IL4)    04658 Th1 and Th2 cell differentiation     144235367 (IL4)    04659 Th17 cell differentiation     144235367 (IL4)    04657 IL-17 signaling pathway     144235367 (IL4)    04664 Fc epsilon RI signaling pathway     144235367 (IL4)    04672 Intestinal immune network for IgA production     144235367 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     144235367 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     144235367 (IL4)   09163 Immune disease    05310 Asthma     144235367 (IL4)    05320 Autoimmune thyroid disease     144235367 (IL4)    05321 Inflammatory bowel disease     144235367 (IL4)    05330 Allograft rejection     144235367 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccru04052]     144235367 (IL4)    00536 Glycosaminoglycan binding proteins [BR:ccru00536]     144235367 (IL4) Cytokines and neuropeptides [BR:ccru04052]  Cytokines   Interleukins    144235367 (IL4) Glycosaminoglycan binding proteins [BR:ccru00536]  Heparan sulfate / Heparin   Cytokines    144235367 (IL4) SSDB OrthologParalogGFIT Motif Pfam:  IL4 MboIIR_mid Motif Other DBs NCBI-GeneID:  144235367 NCBI-ProteinID:  XP_077625045 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MDLTSQLIPTLVCLLAFTSTFVHGQNFNIRLREIIKTLNILTARNDSCMELTVMDVLAAP KNTSDQEIFCRATTVLRQTYTHPNCSTRFLRGLDKNLWSMANRTCAVNEVKKCTLKDLLE RLKAIVQKIYSKH NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggatctcacctcccaactgattccaactctggtctgcttactagcatttaccagcacc ttcgtccacggccagaacttcaatatcaggttgagagagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcgtgtatggagctgaccgtcatggacgtcttggctgcccca aagaacacaagtgatcaggaaatcttctgcagagccacaactgtgctccggcagacctat acacaccccaactgctcgaccagattcctcagaggactcgacaagaacctctggagcatg gcaaacaggacctgtgctgtgaatgaagtcaagaagtgtacactgaaagacctgttggaa aggctaaaagcgatcgtgcaaaagatatactcaaagcactga

DBGET integrated database retrieval system