Crocuta crocuta (spotted hyena): 144240865 Help Entry 144240865         CDS       T11532                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04010   MAPK signaling pathway ccru04014   Ras signaling pathway ccru04015   Rap1 signaling pathway ccru04024   cAMP signaling pathway ccru04062   Chemokine signaling pathway ccru04510   Focal adhesion ccru04517   IgSF CAM signaling ccru04520   Adherens junction ccru04611   Platelet activation ccru04670   Leukocyte transendothelial migration ccru04720   Long-term potentiation ccru04722   Neurotrophin signaling pathway ccru04934   Cushing syndrome ccru04972   Pancreatic secretion ccru05211   Renal cell carcinoma ccru05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     144240865 (RAP1B)    04014 Ras signaling pathway     144240865 (RAP1B)    04015 Rap1 signaling pathway     144240865 (RAP1B)    04024 cAMP signaling pathway     144240865 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     144240865 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     144240865 (RAP1B)    04520 Adherens junction     144240865 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     144240865 (RAP1B)    04670 Leukocyte transendothelial migration     144240865 (RAP1B)    04062 Chemokine signaling pathway     144240865 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     144240865 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     144240865 (RAP1B)    04722 Neurotrophin signaling pathway     144240865 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     144240865 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     144240865 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     144240865 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144240865 (RAP1B)    04031 GTP-binding proteins [BR:ccru04031]     144240865 (RAP1B) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144240865 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    144240865 (RAP1B)   Exosomal proteins of colorectal cancer cells    144240865 (RAP1B) GTP-binding proteins [BR:ccru04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     144240865 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  144240865 NCBI-ProteinID:  XP_077631403 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaat tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacacgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system