Corvus cornix (hooded crow): 104698369 Help Entry 104698369         CDS       T03546                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism ccw  Corvus cornix (hooded crow) Pathway ccw03050   Proteasome ccw04060   Cytokine-cytokine receptor interaction ccw04217   Necroptosis ccw04350   TGF-beta signaling pathway ccw05164   Influenza A ccw05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ccw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     104698369 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     104698369 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104698369 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104698369 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104698369 (IFNG)    05168 Herpes simplex virus 1 infection     104698369 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ccw03051]     104698369 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccw04052]     104698369 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:ccw00536]     104698369 (IFNG) Proteasome [BR:ccw03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     104698369 (IFNG) Cytokines and neuropeptides [BR:ccw04052]  Cytokines   Interferons    104698369 (IFNG) Glycosaminoglycan binding proteins [BR:ccw00536]  Heparan sulfate / Heparin   Cytokines    104698369 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Fib_alpha DUF948 ATG14 Lipoprotein_20 ADIP Sec8_N Phage_GP20 Seryl_tRNA_N TMPIT Motif Other DBs NCBI-GeneID:  104698369 NCBI-ProteinID:  XP_010411965 LinkDB All DBs Position 1A:complement(34224318..34228658) Genome browser AA seq 165 aa AA seqDB search MAFQIYSLFVLSIIMVSFGHVENRLHLLQLQNDIDKLKADFNSSHSDVADGGPIFTEKLS GWTERNEKRIILSQIISMYLKMLENTDRSKAHVRNISEELHTLKESLSDGSKKIEDLKDL TKLQMSDLKIQRKAVNELFSVLQKLGDTSSSHKRKRRQFQRLCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggctttccaaatctacagcttgtttgttctgtctatcatcatggtttcttttggacat gttgaaaatagattgcatcttcttcagcttcaaaatgatatagacaaactgaaagctgat tttaactcgagtcattctgatgtagctgatggtggacctatttttacagagaagctatca ggctggacagagagaaatgaaaaaaggatcatcctgagtcagattatttccatgtacttg aaaatgcttgaaaacactgacaggtcaaaggctcatgtgaggaacatatctgaggagctc catactctgaaagaaagcctttctgacggctcaaagaagatagaagatctcaaagacctg acaaaacttcagatgagtgacttgaaaattcagcgcaaggctgtgaatgagctgttcagt gtcctacaaaaactgggggatacctcaagttcccacaaaagaaaaagaaggcagtttcag aggctgtgcaaatgctaa

DBGET integrated database retrieval system