Camelus dromedarius (Arabian camel): 105086086 Help Entry 105086086         CDS       T04642                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk01522   Endocrine resistance cdk04010   MAPK signaling pathway cdk04024   cAMP signaling pathway cdk04210   Apoptosis cdk04380   Osteoclast differentiation cdk04620   Toll-like receptor signaling pathway cdk04657   IL-17 signaling pathway cdk04658   Th1 and Th2 cell differentiation cdk04659   Th17 cell differentiation cdk04660   T cell receptor signaling pathway cdk04662   B cell receptor signaling pathway cdk04668   TNF signaling pathway cdk04713   Circadian entrainment cdk04725   Cholinergic synapse cdk04728   Dopaminergic synapse cdk04915   Estrogen signaling pathway cdk04917   Prolactin signaling pathway cdk04921   Oxytocin signaling pathway cdk04926   Relaxin signaling pathway cdk04928   Parathyroid hormone synthesis, secretion and action cdk04932   Non-alcoholic fatty liver disease cdk04935   Growth hormone synthesis, secretion and action cdk05031   Amphetamine addiction cdk05132   Salmonella infection cdk05133   Pertussis cdk05135   Yersinia infection cdk05140   Leishmaniasis cdk05142   Chagas disease cdk05161   Hepatitis B cdk05162   Measles cdk05166   Human T-cell leukemia virus 1 infection cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05170   Human immunodeficiency virus 1 infection cdk05171   Coronavirus disease - COVID-19 cdk05200   Pathways in cancer cdk05207   Chemical carcinogenesis - receptor activation cdk05208   Chemical carcinogenesis - reactive oxygen species cdk05210   Colorectal cancer cdk05224   Breast cancer cdk05231   Choline metabolism in cancer cdk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cdk05323   Rheumatoid arthritis cdk05417   Lipid and atherosclerosis cdk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105086086 (FOS)    04668 TNF signaling pathway     105086086 (FOS)    04024 cAMP signaling pathway     105086086 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105086086 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105086086 (FOS)    04660 T cell receptor signaling pathway     105086086 (FOS)    04658 Th1 and Th2 cell differentiation     105086086 (FOS)    04659 Th17 cell differentiation     105086086 (FOS)    04657 IL-17 signaling pathway     105086086 (FOS)    04662 B cell receptor signaling pathway     105086086 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     105086086 (FOS)    04917 Prolactin signaling pathway     105086086 (FOS)    04921 Oxytocin signaling pathway     105086086 (FOS)    04926 Relaxin signaling pathway     105086086 (FOS)    04935 Growth hormone synthesis, secretion and action     105086086 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     105086086 (FOS)   09156 Nervous system    04725 Cholinergic synapse     105086086 (FOS)    04728 Dopaminergic synapse     105086086 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     105086086 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     105086086 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105086086 (FOS)    05207 Chemical carcinogenesis - receptor activation     105086086 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     105086086 (FOS)    05231 Choline metabolism in cancer     105086086 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105086086 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     105086086 (FOS)    05224 Breast cancer     105086086 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105086086 (FOS)    05170 Human immunodeficiency virus 1 infection     105086086 (FOS)    05161 Hepatitis B     105086086 (FOS)    05171 Coronavirus disease - COVID-19     105086086 (FOS)    05162 Measles     105086086 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     105086086 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105086086 (FOS)    05135 Yersinia infection     105086086 (FOS)    05133 Pertussis     105086086 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105086086 (FOS)    05142 Chagas disease     105086086 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     105086086 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     105086086 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105086086 (FOS)    05418 Fluid shear stress and atherosclerosis     105086086 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105086086 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105086086 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cdk03000]     105086086 (FOS)    04131 Membrane trafficking [BR:cdk04131]     105086086 (FOS) Transcription factors [BR:cdk03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     105086086 (FOS) Membrane trafficking [BR:cdk04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105086086 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  105086086 NCBI-ProteinID:  XP_010974777 LinkDB All DBs Position 6:72262108..72265529 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSTGAYPRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPAKSSSSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggatttctgtaccgatctggccgtctccagtgccaacttc atcccaacagtgacggccatctcgaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagctccccacccctatggagtccccact ccctcgactggggcttaccccagggctggagtcgtgaagactatgacaggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggagacagaccaattagaagatgagaagtccgctttgcag actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcat cgacctgcctgcaagatccctgatgacctgggtttcccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgcctgaggctgccaccccggaatccgaggaggccttcacc ctgcccctcctaaatgaccctgagcccaagccctcagtggagcccgccaagagctccagc agcatggagctgaaggctgagccctttgatgacttcttgttcccagcatcttccaggccc agcggctctgagaccgcacgttctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggttccctggggatggggcccatggccacagagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtctttacctaccccgaggctgactccttccccagctgtgcagctgctcaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system