Camelus dromedarius (Arabian camel): 105091368 Help Entry 105091368         CDS       T04642                                  Name (RefSeq) permeability factor 2   KO K05505   C-X-C motif chemokine 1/2/3 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway cdk04064   NF-kappa B signaling pathway cdk04621   NOD-like receptor signaling pathway cdk04657   IL-17 signaling pathway cdk04668   TNF signaling pathway cdk04936   Alcoholic liver disease cdk05134   Legionellosis cdk05146   Amoebiasis cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05323   Rheumatoid arthritis cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105091368    04668 TNF signaling pathway     105091368   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105091368    04061 Viral protein interaction with cytokine and cytokine receptor     105091368  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105091368    04657 IL-17 signaling pathway     105091368    04062 Chemokine signaling pathway     105091368  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     105091368   09171 Infectious disease: bacterial    05134 Legionellosis     105091368   09174 Infectious disease: parasitic    05146 Amoebiasis     105091368   09163 Immune disease    05323 Rheumatoid arthritis     105091368   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105091368   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105091368  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105091368 Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105091368 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105091368 NCBI-ProteinID:  XP_031318437 LinkDB All DBs Position 2:71829022..71831202 Genome browser AA seq 128 aa AA seqDB search MSGNFPAPGCELLSHQDKRGSLAPWPAPRPPPPPGSSAPRCCSCSWWPPARRAAGVPVVT ELRCHCLQTLQGIHFKNIQSVKVTAPGPHCGQTEVIATLKNGQEACLNPAAPMVKKIVDK MLNKGSSS NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtccgggaatttccctgccccgggctgcgagctcctgtcccatcaggataaaaggggt tccctggccccatggcccgcaccgcgacccccgccgccccccggctcctccgcgccgcgc tgctgctcctgctcctggtggccgccggcccggcgcgcagcaggggtgcctgtggtcacc gaactgcgctgccactgcttgcagaccttgcagggaattcacttcaagaacatccagagc gtgaaggtgacggccccgggaccccactgtggccaaacggaagtcatagccactctcaag aatggccaggaagcttgtctcaaccccgcagcccccatggttaagaaaatagtcgacaag atgctaaacaagggcagctccagctga

DBGET integrated database retrieval system