Camelus dromedarius (Arabian camel): 105095933 Help Entry 105095933         CDS       T04642                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04151   PI3K-Akt signaling pathway cdk04217   Necroptosis cdk04380   Osteoclast differentiation cdk04620   Toll-like receptor signaling pathway cdk04621   NOD-like receptor signaling pathway cdk04622   RIG-I-like receptor signaling pathway cdk04623   Cytosolic DNA-sensing pathway cdk04630   JAK-STAT signaling pathway cdk04650   Natural killer cell mediated cytotoxicity cdk04668   TNF signaling pathway cdk04936   Alcoholic liver disease cdk05135   Yersinia infection cdk05142   Chagas disease cdk05152   Tuberculosis cdk05160   Hepatitis C cdk05161   Hepatitis B cdk05162   Measles cdk05163   Human cytomegalovirus infection cdk05164   Influenza A cdk05165   Human papillomavirus infection cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05168   Herpes simplex virus 1 infection cdk05169   Epstein-Barr virus infection cdk05170   Human immunodeficiency virus 1 infection cdk05171   Coronavirus disease - COVID-19 cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105095933 (IFNB1)    04668 TNF signaling pathway     105095933 (IFNB1)    04151 PI3K-Akt signaling pathway     105095933 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105095933 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105095933 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105095933 (IFNB1)    04621 NOD-like receptor signaling pathway     105095933 (IFNB1)    04622 RIG-I-like receptor signaling pathway     105095933 (IFNB1)    04623 Cytosolic DNA-sensing pathway     105095933 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     105095933 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     105095933 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105095933 (IFNB1)    05161 Hepatitis B     105095933 (IFNB1)    05160 Hepatitis C     105095933 (IFNB1)    05171 Coronavirus disease - COVID-19     105095933 (IFNB1)    05164 Influenza A     105095933 (IFNB1)    05162 Measles     105095933 (IFNB1)    05168 Herpes simplex virus 1 infection     105095933 (IFNB1)    05163 Human cytomegalovirus infection     105095933 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     105095933 (IFNB1)    05169 Epstein-Barr virus infection     105095933 (IFNB1)    05165 Human papillomavirus infection     105095933 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     105095933 (IFNB1)    05152 Tuberculosis     105095933 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     105095933 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105095933 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105095933 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105095933 (IFNB1) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Interferons    105095933 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Benyvirus_14KDa Motif Other DBs NCBI-GeneID:  105095933 NCBI-ProteinID:  XP_010986446 UniProt:  A0A5N4E9B0 LinkDB All DBs Position 4:6710021..6710581 Genome browser AA seq 186 aa AA seqDB search MIDRCILQIALLLCFSTTALSVNYNLLRYQQRSSNLACKNLLRQMPGIPQYCLKDRMDFD VPEEIKQPQQFQKEDAVLVIYEMLQQIFGIFRRDFSSTGWNKAIIEDLLVEIDVRIDHVE TILAEIMKEKNFTRGDMTILHLRMYYLKIVQYLKSKEYSGCAWTVVQAEILRNFSFLNSL TECLQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgatcgacaggtgcatcctccaaatcgctctcctattgtgtttctccaccacagctctt tccgtgaactacaacttgcttcggtaccaacaaaggagcagcaacttggcatgtaagaat ctcctgcggcagatgcctggaatccctcagtattgcctcaaggacaggatggactttgac gtccctgaggagattaagcaaccccagcagttccagaaggaagatgccgtattggtcatc tatgagatgctccagcagatctttggtattttcagaagagatttctcaagcactggctgg aataaggccatcattgaggatctccttgtagaaatcgatgtgcggatagaccatgtggag acaatcctggcggaaataatgaaggagaaaaacttcaccaggggagacatgaccatcctt cacctaaggatgtattacttaaagatcgtgcagtacttgaagtccaaggaatacagcggc tgtgcctggacagtagtccaagcggaaatcctcaggaatttttccttccttaacagtctt acagaatgccttcaggactga

DBGET integrated database retrieval system