Camelus dromedarius (Arabian camel): 105104077 Help Entry 105104077         CDS       T04642                                  Name (RefSeq) actin-like   KO K05692   actin beta/gamma 1 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk03082   ATP-dependent chromatin remodeling cdk04015   Rap1 signaling pathway cdk04145   Phagosome cdk04210   Apoptosis cdk04390   Hippo signaling pathway cdk04510   Focal adhesion cdk04520   Adherens junction cdk04530   Tight junction cdk04611   Platelet activation cdk04613   Neutrophil extracellular trap formation cdk04670   Leukocyte transendothelial migration cdk04714   Thermogenesis cdk04810   Regulation of actin cytoskeleton cdk04814   Motor proteins cdk04820   Cytoskeleton in muscle cells cdk04919   Thyroid hormone signaling pathway cdk04921   Oxytocin signaling pathway cdk04971   Gastric acid secretion cdk05014   Amyotrophic lateral sclerosis cdk05100   Bacterial invasion of epithelial cells cdk05132   Salmonella infection cdk05135   Yersinia infection cdk05164   Influenza A cdk05205   Proteoglycans in cancer cdk05225   Hepatocellular carcinoma cdk05410   Hypertrophic cardiomyopathy cdk05412   Arrhythmogenic right ventricular cardiomyopathy cdk05414   Dilated cardiomyopathy cdk05416   Viral myocarditis cdk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105104077  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105104077    04390 Hippo signaling pathway     105104077  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105104077   09143 Cell growth and death    04210 Apoptosis     105104077   09144 Cellular community - eukaryotes    04510 Focal adhesion     105104077    04520 Adherens junction     105104077    04530 Tight junction     105104077   09142 Cell motility    04814 Motor proteins     105104077    04820 Cytoskeleton in muscle cells     105104077    04810 Regulation of actin cytoskeleton     105104077  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     105104077    04613 Neutrophil extracellular trap formation     105104077    04670 Leukocyte transendothelial migration     105104077   09152 Endocrine system    04921 Oxytocin signaling pathway     105104077    04919 Thyroid hormone signaling pathway     105104077   09154 Digestive system    04971 Gastric acid secretion     105104077   09159 Environmental adaptation    04714 Thermogenesis     105104077  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105104077   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105104077   09172 Infectious disease: viral    05164 Influenza A     105104077   09171 Infectious disease: bacterial    05132 Salmonella infection     105104077    05135 Yersinia infection     105104077    05100 Bacterial invasion of epithelial cells     105104077   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105104077   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105104077    05410 Hypertrophic cardiomyopathy     105104077    05412 Arrhythmogenic right ventricular cardiomyopathy     105104077    05414 Dilated cardiomyopathy     105104077    05416 Viral myocarditis     105104077  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cdk03021]     105104077    03019 Messenger RNA biogenesis [BR:cdk03019]     105104077    03036 Chromosome and associated proteins [BR:cdk03036]     105104077    03029 Mitochondrial biogenesis [BR:cdk03029]     105104077   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cdk04812]     105104077    04147 Exosome [BR:cdk04147]     105104077 Transcription machinery [BR:cdk03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      105104077 Messenger RNA biogenesis [BR:cdk03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105104077 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      105104077     NuA4 complex      105104077   Chromatin remodeling factors    BAF complex     105104077    PBAF complex     105104077    GBAF(ncBAF) complex     105104077    SWR1 complex     105104077 Mitochondrial biogenesis [BR:cdk03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     105104077 Cytoskeleton proteins [BR:cdk04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      105104077 Exosome [BR:cdk04147]  Exosomal proteins   Proteins found in most exosomes    105104077 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  105104077 NCBI-ProteinID:  XP_031316613 LinkDB All DBs Position 11:complement(75179550..75187647) Genome browser AA seq 355 aa AA seqDB search MVLPRAKTKPRAVFPSIVGCPRHQGVIVGVGQKDSYVGDEAQSKCGILTLKYPVERGIIT NWDDMEKTWHHTFYKELHMAPKEHPVLLTEAPLNPKANCEKMTQIMFEIFNTLAMYVAIQ AVLSLYASGHTTGIVMDSGDGVTHTVPIYEGYALPHAVLRLDLAGRDLTDYLMKILTERG YSFTTTAEREIVCDIKEKLCYVTLDFEQEMATAASSSSLEKSYELPDCVITVGNERFWCP EVLFQPSFLGMESRGIHETTFNSIMKCDVHIRKDLYANTVLSGGTAMYPGIADRMQKEIT ALAPSTMKIKIIAPPEHKYTVWIGGSILAWLSTFLQMWISKLGASTKKINIIMCD NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt atggttctgccacgtgcaaagacgaagccccgggctgtcttcccttccattgtaggctgt ccccgacaccagggcgtcatagtgggtgtggggcagaaggacagctacgtgggcgatgag gcccagagcaagtgcggcatcctgactctcaagtaccccgttgagcgtggcatcatcacc aactgggacgacatggagaaaacctggcaccacaccttctacaaagagctgcacatggcc cccaaggagcaccctgtgctgctgaccgaggcccccctgaaccccaaggccaactgtgag aagatgacccagatcatgttcgagatcttcaacaccctggccatgtacgtggccatccag gctgtgctgtccctgtacgcctctggccacaccactggtattgtcatggactctggggat ggggtcacccacactgtgcccatctacgagggctatgccctcccacacgctgtcctgcgt ctggacctggctggccgggacctgacagactacctcatgaagatcctcactgagcgtggc tacagcttcaccaccacggccgagcgggaaattgtgtgtgacatcaaggagaagctctgc tacgtcaccctggacttcgagcaggagatggccactgctgcctccagctcctccctggag aagagctatgagctgcccgactgcgtcatcaccgtcggcaacgagcgcttctggtgtcca gaggtgcttttccagccctccttcctgggtatggagtcacgtggcatccacgaaaccacc ttcaactccatcatgaagtgtgatgtccacatccggaaggacctgtacgccaacacggtg ctgtctggtgggaccgccatgtaccccggcattgccgacaggatgcagaaggagatcacg gccctggcccccagcacgatgaagatcaagatcatcgctcctcccgagcacaagtacacc gtgtggatcgggggctccatcctggcctggctgtccaccttcctgcagatgtggatcagc aagctgggcgctagcaccaagaagatcaacatcatcatgtgcgattaa

DBGET integrated database retrieval system