Dickeya fangzhongdai ND14b: LH89_16955 Help Entry LH89_16955        CDS       T03347                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ced  Dickeya fangzhongdai ND14b Pathway ced00790   Folate biosynthesis ced01100   Metabolic pathways ced01240   Biosynthesis of cofactors Module ced_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ced00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LH89_16955 (folB) Enzymes [BR:ced01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LH89_16955 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LH89_16955 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LH89_16955 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF2726 Motif Other DBs NCBI-ProteinID:  AIR70820 UniProt:  A0A2K8QRE8 LinkDB All DBs Position 3820064..3820426 Genome browser AA seq 120 aa AA seqDB search MDIVFIEELSVITTIGVYDWEQTIQQKLMFDIEMAWDNRPAAASDDVADCLSYADVSEAV IELVAGGRFALVERVAEEVAATLMQRFGIPWLRLKVSKPGAVAQARSVGVVIERGVRPSA NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatatcgtgtttattgaagaactgagcgtaatcaccaccatcggtgtttatgactgg gaacagaccatccagcagaagttgatgttcgatatcgaaatggcctgggataaccgcccg gccgccgccagcgacgacgtagccgattgcctgagctatgccgatgtcagcgaggcggtg attgaactggtcgccggcgggcgatttgcgctggtggagcgggtggctgaagaggtggcg gccacactgatgcagcgcttcggcattccctggctgcggctgaaggtcagcaagcccggc gcggtggcgcaggcgcgcagcgtgggcgtggtgattgaacgcggcgtccgcccgtcggca tga

DBGET integrated database retrieval system