Cellvibrio sp. KY-GH-1: D0C16_02145
Help
Entry
D0C16_02145 CDS
T06422
Symbol
fabG
Name
(GenBank) 3-oxoacyl-ACP reductase FabG
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
ceg
Cellvibrio sp. KY-GH-1
Pathway
ceg00061
Fatty acid biosynthesis
ceg00780
Biotin metabolism
ceg01100
Metabolic pathways
ceg01110
Biosynthesis of secondary metabolites
ceg01212
Fatty acid metabolism
ceg01240
Biosynthesis of cofactors
Module
ceg_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
ceg00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
D0C16_02145 (fabG)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
D0C16_02145 (fabG)
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
D0C16_02145 (fabG)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
ceg01004
]
D0C16_02145 (fabG)
Enzymes [BR:
ceg01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
D0C16_02145 (fabG)
Lipid biosynthesis proteins [BR:
ceg01004
]
Fatty acid synthase
Component type
D0C16_02145 (fabG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
Epimerase
DUF1776
SDR
Motif
Other DBs
NCBI-ProteinID:
QEY14876
LinkDB
All DBs
Position
519237..519980
Genome browser
AA seq
247 aa
AA seq
DB search
MSLNDKVALVTGASRGIGAAIAEQLGKAGATVIGTATSQSGAEKISARFTELGIRGVGKV
LNVTDADSVANLLKEVGDEFGAPAILVNNAGITKDNLLMRMSDEEWFDVINTNLSAIYRL
SKGVLRGMMKARWGRIINISSVVGAMGNPGQSNYAATKAGVSGFARSLAAEVGSRNITVN
TVAPGFIDTDMTKVLPEEQKQQLMSRIPLGRLGAPEEIASVVVFLASDAGSYISGETIHV
NGGMYMS
NT seq
744 nt
NT seq
+upstream
nt +downstream
nt
atgagcttaaatgataaagtcgccttggttactggtgcgagccgtggtattggtgcagca
attgctgagcagctcggcaaggctggcgcaactgtaattggtacggcaaccagtcagtct
ggcgcagaaaaaatttctgcccgcttcacagagttgggtattcgtggcgtgggcaaggtg
ctaaacgtaactgatgctgattcagtggcaaacttattaaaagaagttggtgacgaattt
ggtgcaccggcaattctggttaataatgcgggtattaccaaagacaatctcttgatgcgc
atgagtgatgaggagtggtttgatgttatcaataccaatctcagtgcaatttaccgttta
agcaaaggcgtgttgcgcggaatgatgaaagcccgttgggggcgaattatcaatattagt
tcggttgttggtgcgatgggtaatcccgggcaatcaaactatgccgcaactaaagcgggt
gtttctggttttgcacgctcgctagctgctgaagtggggtcgcgcaatattaccgtgaat
acagtggctccaggttttattgatacagatatgaccaaggtgttgccggaagagcaaaaa
caacaactcatgtctcgtattcctctcgggcgtcttggggctcccgaagaaattgcgtcg
gttgttgtttttctggccagcgatgctggatcttacatcagtggagagacaattcatgtc
aacggcggcatgtatatgtcgtaa
DBGET
integrated database retrieval system