Canis lupus familiaris (dog): 119872320 Help Entry 119872320         CDS       T01007                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism cfa  Canis lupus familiaris (dog) Pathway cfa00510   N-Glycan biosynthesis cfa00513   Various types of N-glycan biosynthesis cfa04141   Protein processing in endoplasmic reticulum Module cfa_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cfa00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     119872320    00513 Various types of N-glycan biosynthesis     119872320  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119872320 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 Motif Other DBs NCBI-GeneID:  119872320 NCBI-ProteinID:  XP_038389568 LinkDB All DBs Position 6:7542107..7545771 Genome browser AA seq 88 aa AA seqDB search MTLFSPPGEMELEAMSRYTSPVNLAFFPHLTMVLLAIGMFFTAWFFIYEVTSTKYTRNIY KELLISLVASLFMGFGVLFLLLWVGIYV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaccctgttttcgccacctggcgaaatggagctcgaggccatgagcagatacaccagc ccagtgaaccttgccttcttcccccatctgaccatggtgctattggcaattggcatgttc tttaccgcctggttcttcatttatgaggtcacctccaccaagtacactcggaatatctac aaagagctcctcatctccttggtggcctcactcttcatgggttttggagtcctcttcctg ctgctctgggttggcatctacgtatga

DBGET integrated database retrieval system