Canis lupus familiaris (dog): 403869 Help Entry 403869            CDS       T01007                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism cfa  Canis lupus familiaris (dog) Pathway cfa01522   Endocrine resistance cfa01524   Platinum drug resistance cfa04010   MAPK signaling pathway cfa04071   Sphingolipid signaling pathway cfa04110   Cell cycle cfa04115   p53 signaling pathway cfa04137   Mitophagy - animal cfa04151   PI3K-Akt signaling pathway cfa04210   Apoptosis cfa04211   Longevity regulating pathway cfa04216   Ferroptosis cfa04218   Cellular senescence cfa04310   Wnt signaling pathway cfa04722   Neurotrophin signaling pathway cfa04919   Thyroid hormone signaling pathway cfa05012   Parkinson disease cfa05014   Amyotrophic lateral sclerosis cfa05016   Huntington disease cfa05160   Hepatitis C cfa05161   Hepatitis B cfa05162   Measles cfa05163   Human cytomegalovirus infection cfa05165   Human papillomavirus infection cfa05166   Human T-cell leukemia virus 1 infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05168   Herpes simplex virus 1 infection cfa05169   Epstein-Barr virus infection cfa05200   Pathways in cancer cfa05202   Transcriptional misregulation in cancer cfa05203   Viral carcinogenesis cfa05205   Proteoglycans in cancer cfa05206   MicroRNAs in cancer cfa05210   Colorectal cancer cfa05212   Pancreatic cancer cfa05213   Endometrial cancer cfa05214   Glioma cfa05215   Prostate cancer cfa05216   Thyroid cancer cfa05217   Basal cell carcinoma cfa05218   Melanoma cfa05219   Bladder cancer cfa05220   Chronic myeloid leukemia cfa05222   Small cell lung cancer cfa05223   Non-small cell lung cancer cfa05224   Breast cancer cfa05225   Hepatocellular carcinoma cfa05226   Gastric cancer cfa05230   Central carbon metabolism in cancer cfa05417   Lipid and atherosclerosis cfa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     403869 (TP53)    04310 Wnt signaling pathway     403869 (TP53)    04071 Sphingolipid signaling pathway     403869 (TP53)    04151 PI3K-Akt signaling pathway     403869 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     403869 (TP53)   09143 Cell growth and death    04110 Cell cycle     403869 (TP53)    04210 Apoptosis     403869 (TP53)    04216 Ferroptosis     403869 (TP53)    04115 p53 signaling pathway     403869 (TP53)    04218 Cellular senescence     403869 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     403869 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     403869 (TP53)   09149 Aging    04211 Longevity regulating pathway     403869 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     403869 (TP53)    05202 Transcriptional misregulation in cancer     403869 (TP53)    05206 MicroRNAs in cancer     403869 (TP53)    05205 Proteoglycans in cancer     403869 (TP53)    05203 Viral carcinogenesis     403869 (TP53)    05230 Central carbon metabolism in cancer     403869 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     403869 (TP53)    05212 Pancreatic cancer     403869 (TP53)    05225 Hepatocellular carcinoma     403869 (TP53)    05226 Gastric cancer     403869 (TP53)    05214 Glioma     403869 (TP53)    05216 Thyroid cancer     403869 (TP53)    05220 Chronic myeloid leukemia     403869 (TP53)    05217 Basal cell carcinoma     403869 (TP53)    05218 Melanoma     403869 (TP53)    05219 Bladder cancer     403869 (TP53)    05215 Prostate cancer     403869 (TP53)    05213 Endometrial cancer     403869 (TP53)    05224 Breast cancer     403869 (TP53)    05222 Small cell lung cancer     403869 (TP53)    05223 Non-small cell lung cancer     403869 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     403869 (TP53)    05161 Hepatitis B     403869 (TP53)    05160 Hepatitis C     403869 (TP53)    05162 Measles     403869 (TP53)    05168 Herpes simplex virus 1 infection     403869 (TP53)    05163 Human cytomegalovirus infection     403869 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     403869 (TP53)    05169 Epstein-Barr virus infection     403869 (TP53)    05165 Human papillomavirus infection     403869 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     403869 (TP53)    05014 Amyotrophic lateral sclerosis     403869 (TP53)    05016 Huntington disease     403869 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     403869 (TP53)    05418 Fluid shear stress and atherosclerosis     403869 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     403869 (TP53)    01522 Endocrine resistance     403869 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cfa03000]     403869 (TP53)    03036 Chromosome and associated proteins [BR:cfa03036]     403869 (TP53)    03400 DNA repair and recombination proteins [BR:cfa03400]     403869 (TP53) Transcription factors [BR:cfa03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     403869 (TP53) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      403869 (TP53) DNA repair and recombination proteins [BR:cfa03400]  Eukaryotic type   Check point factors    Other check point factors     403869 (TP53) SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  403869 NCBI-ProteinID:  NP_001376147 Ensembl:  ENSCAFG00000016714 VGNC:  47719 UniProt:  A0A8C0RLV2 LinkDB All DBs Position 5:complement(32699559..32713071) Genome browser AA seq 381 aa AA seqDB search MQEPQSELNIDPPLSQETFSELWNLLPENNVLSSELCPAVDELLLPESVVNWLDEDSDDA PRMPATSAPTAPGPAPSWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTWTYSPLLNKL FCQLAKTCPVQLWVSSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGMNRRPIL TIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPEPPPGSTKRALPPST SSSPPQKKKPLDGEYFTLQIRGRERYEMFRNLNEALELKDAQSGKEPGGSRAHSSHLKAK KGQSTSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgcaagagccacagtcagagctcaatatcgacccccctctgagccaggagacattttca gaattgtggaacctgcttcctgaaaacaatgttctgtcttcggagctgtgcccagcagtg gatgagctgctgctcccagagagcgtcgtgaactggctagacgaagactcagatgatgct cccaggatgccagccacttctgcccccacagcccctggaccggccccctcctggccccta tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtttggggttc ctgcattccgggacagccaagtctgttacttggacgtactcccctctcctcaacaagttg ttttgccagctggcgaagacctgccccgtgcagctgtgggtcagctccccacccccaccc aatacctgcgtccgcgctatggccatctataagaagtcggagttcgtgaccgaggttgtg cggcgctgcccccaccatgaacgctgctctgacagtagtgacggtcttgcccctcctcag catctcatccgagtggaaggaaatttgcgggccaagtacctggacgacagaaacactttt cgacacagtgtggtggtgccttatgagccacccgaggttggctctgactataccaccatc cactacaactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc actatcatcaccctggaagactccagtggaaacgtgctgggacgcaacagctttgaggta cgcgtttgtgcctgtcccgggagagaccgccggactgaggaggagaatttccacaagaag ggggagccttgtcctgagccaccccccgggagtaccaagcgagcactgcctcccagcacc agctcctctcccccgcaaaagaagaagccactagatggagaatatttcacccttcagatc cgtgggcgtgaacgctatgagatgttcaggaatctgaatgaagccttggagctgaaggat gcccagagtggaaaggagccagggggaagcagggctcactccagccacctgaaggcaaag aaggggcaatctacctctcgccataaaaaactgatgttcaagagagaagggcccgactca gactga

DBGET integrated database retrieval system