Canis lupus familiaris (dog): 487528 Help Entry 487528            CDS       T01007                                  Symbol HYPK Name (RefSeq) huntingtin-interacting protein K   KO K28128   huntingtin-interacting protein K Organism cfa  Canis lupus familiaris (dog) Brite KEGG Orthology (KO) [BR:cfa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cfa03110]     487528 (HYPK)    03036 Chromosome and associated proteins [BR:cfa03036]     487528 (HYPK) Chaperones and folding catalysts [BR:cfa03110]  Other chaperones and cochaperones   Others    487528 (HYPK) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Sister chromatid cohesion proteins    Other sister chromatid cohesion factors     487528 (HYPK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  UBA_HYPK UBA_7 SPT6_acidic Motif Other DBs NCBI-GeneID:  487528 NCBI-ProteinID:  XP_544652 Ensembl:  ENSCAFG00000044459 UniProt:  A0A8I3PPP4 LinkDB All DBs Position 30:10599664..10602970 Genome browser AA seq 121 aa AA seqDB search MATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIG DRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALT N NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggctaccgagggggatgtggagctggagttggagactgagaccagcggcccggagcgg cctcccgagaagccacggaagcatgacagcggtgcggcggacctggagcgagtcaccgac tacgcggaggagaaggagatccagagttccaatttggagacggccatgtccgtcatcgga gacagacggtcccgggaacagaaagccaaacaggagcgggagaaggaactggccaaagtc accattaagaaggaagatctggagctgataatgacagagatggagatctcacgagcagca gcagaacggagcttgagggaacacatgggcaacgtggtagaggctcttattgccctaacc aactga

DBGET integrated database retrieval system