Canis lupus familiaris (dog): 608981 Help Entry 608981            CDS       T01007                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism cfa  Canis lupus familiaris (dog) Pathway cfa04010   MAPK signaling pathway cfa04014   Ras signaling pathway cfa04015   Rap1 signaling pathway cfa04024   cAMP signaling pathway cfa04062   Chemokine signaling pathway cfa04510   Focal adhesion cfa04520   Adherens junction cfa04611   Platelet activation cfa04670   Leukocyte transendothelial migration cfa04720   Long-term potentiation cfa04722   Neurotrophin signaling pathway cfa04934   Cushing syndrome cfa04972   Pancreatic secretion cfa05211   Renal cell carcinoma cfa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     608981 (RAP1B)    04014 Ras signaling pathway     608981 (RAP1B)    04015 Rap1 signaling pathway     608981 (RAP1B)    04024 cAMP signaling pathway     608981 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     608981 (RAP1B)    04520 Adherens junction     608981 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     608981 (RAP1B)    04670 Leukocyte transendothelial migration     608981 (RAP1B)    04062 Chemokine signaling pathway     608981 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     608981 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     608981 (RAP1B)    04722 Neurotrophin signaling pathway     608981 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     608981 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     608981 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     608981 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     608981 (RAP1B)    04031 GTP-binding proteins [BR:cfa04031]     608981 (RAP1B) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    608981 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    608981 (RAP1B)   Exosomal proteins of colorectal cancer cells    608981 (RAP1B) GTP-binding proteins [BR:cfa04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     608981 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  608981 NCBI-ProteinID:  XP_038490280 Ensembl:  ENSCAFG00000000415 UniProt:  A0A8C0TII5 A0A8I3NUL4 LinkDB All DBs Position 10:10700667..10750121 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaatggacaaggctttgcatta gtttactccatcacagcacagtctacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system