Canis lupus familiaris (dog): 609048 Help Entry 609048            CDS       T01007                                  Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism cfa  Canis lupus familiaris (dog) Pathway cfa00670   One carbon pool by folate cfa00790   Folate biosynthesis cfa01100   Metabolic pathways cfa01240   Biosynthesis of cofactors cfa01523   Antifolate resistance cfa04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:cfa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     609048    00670 One carbon pool by folate     609048  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     609048  09160 Human Diseases   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     609048 Enzymes [BR:cfa01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      609048 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-GeneID:  609048 NCBI-ProteinID:  XP_013976939 LinkDB All DBs Position 19:16944408..16945045 Genome browser AA seq 135 aa AA seqDB search MGRKTWFSIPEKNRPLKDRINIVLSRDLKEPPQGAHFLAKSLDDALKLTEQPELANKVDM VWIVGGSSVYKEAMNKPGHLRLFVTRIMHEFEGDTFFPEIDLEKYKLLPEYPGVLSDVQE EKGIKYKFEVYEKND NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgggtaggaagacatggttctctattcctgagaagaatcgacctttaaaggacagaatt aatatagttctcagcagagacctcaaggaacctccacaaggagctcattttcttgccaaa agtctggatgatgctttaaaacttactgagcaaccagaattagcaaataaagtggacatg gtttggatagtgggaggcagttctgtttataaggaagccatgaacaaaccaggccatctt agactatttgtgacaaggattatgcatgaatttgaaggtgacacatttttcccagaaatt gatttggagaaatataaacttctgccagaatacccaggtgttctttctgatgtccaggag gagaaaggcattaagtacaaatttgaagtatatgagaagaacgattaa

DBGET integrated database retrieval system