KEGG   Colletotrichum fioriniae: CFIO01_11821
Entry
CFIO01_11821      CDS       T04796                                 
Name
(GenBank) cytochrome P450 55A1
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00910  Nitrogen metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CFIO01_11821
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cfj00199]
    CFIO01_11821
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     CFIO01_11821
Cytochrome P450 [BR:cfj00199]
 Cytochrome P450, fungi type
  CYP55 family
   CFIO01_11821
SSDB
Motif
Pfam: p450 FluMu_N
Other DBs
NCBI-ProteinID: EXF76434
UniProt: A0A010RFA1
LinkDB
AA seq 398 aa
MTMTTPPNFPFQRASGLEPPAEYARLRATEPVSQVKLFDGSLAWLVTKYKDVCAVATDTR
LSKERTRAGFPELSAGGKAAAANKPTFVDMDAPAHMQQRGMVEPLFVREHIASMKPYIQK
TVDDLLDKMVEQGCDEPVDLIENFALPVPSYIIYTILGVPFEDLEYLTQQNAIRTNGSGT
ALQAQSANQELLNYLAKLVDQRNIEPKNDLISKLVVEQLRPGHIQKSDAVQIAFLLLVAG
NATMVNMIALGVIELFRNPAQLAQLKADPSLAPAFVEELCRYHTGSAMAMKRVAKEDITI
KAGEGIIASNQSGNRDEDVFPDPDVFDMHRTPDPNHALGFGFGPHRCIAEPLARAELETV
FATLFQKLPSLRIALPIPDIEYTPLHKDVGVVKLPVAW
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacgatgaccacgcccccaaacttccccttccaacgcgcctcgggcctcgaaccgccc
gcagaatacgcccgcctccgcgccacagagcccgtctcgcaagtgaagctctttgacggc
tccctcgcatggctcgtgacgaagtacaaagacgtttgcgccgtcgccacggatacgcgt
ctctccaaggagcgcacccgcgccgggttccccgagctcagcgccggcgggaaagcggcg
gcagcgaacaagcccacctttgtcgacatggacgcgccggcacatatgcagcagcgcggg
atggttgagccgctctttgtgcgggagcatatcgcatccatgaagccgtatatccaaaag
actgtggatgatcttttagataagatggttgagcaggggtgcgacgagccggttgactta
atcgagaattttgccttgcctgttccgtcatatatcatctacaccatactcggtgtccca
ttcgaggacctcgagtacctcacccaacagaatgccatccggacgaacggcagcggtacc
gcgttgcaggctcaatctgcaaaccaagaactcctcaactacctcgcaaagctagtcgac
cagcgcaacatcgagcccaaaaacgacctcattagcaagttggtcgtcgaacagctcaga
ccgggtcacattcagaaatcagatgccgtgcaaatcgccttcttgctactcgttgctggc
aatgcgacgatggtcaacatgattgctttgggcgtcatcgaactcttccggaacccagct
cagctcgcccaactcaaagccgacccatcgctcgccccggccttcgtcgaagagctgtgc
agataccacaccggttccgctatggcgatgaagcgtgtggccaaggaggacattaccatc
aaggcgggcgagggcatcatcgcctcaaaccaatccggcaaccgagacgaagacgtcttc
cccgacccggacgtctttgacatgcaccggaccccggacccgaatcacgcgctggggttt
ggcttcgggccgcataggtgtatcgctgagccgctcgcgcgcgcagaactcgagactgtc
tttgcaacgctgttccagaagctccccagcctgagaatcgccctgcccatcccggatatc
gagtatacgcccctgcacaaggatgtcggagtagtcaagttaccggtggcatggtga

DBGET integrated database retrieval system