Cornus florida (flowering dogwood): 132276019 Help Entry 132276019         CDS       T11641                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cflo  Cornus florida (flowering dogwood) Pathway cflo03420   Nucleotide excision repair cflo04120   Ubiquitin mediated proteolysis cflo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cflo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132276019    04120 Ubiquitin mediated proteolysis     132276019   09124 Replication and repair    03420 Nucleotide excision repair     132276019  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cflo04121]     132276019    03400 DNA repair and recombination proteins [BR:cflo03400]     132276019 Enzymes [BR:cflo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      132276019 Ubiquitin system [BR:cflo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    132276019   Multi subunit type E3    SCF complex     Ring finger protein      132276019    Cul2 complex      132276019    Cul3 complex      132276019    Cul4 complex      132276019    Cul7 complex      132276019    Cul8 complex      132276019    Cul9 complex      132276019 DNA repair and recombination proteins [BR:cflo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       132276019     TCR (transcription coupled repair) factors      Cul4-CSA complex       132276019 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  132276019 NCBI-ProteinID:  XP_059633244 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MASLDSDVTMVPAGEGSSGAGPSSSTAVTTLSKKSKRFEIKKWNAVALWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQ KYGH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcttctctggactcagacgtgactatggttcccgcaggcgagggttcgtccggcgct ggaccgtcttcttcaaccgctgtaacaaccttatccaagaagtctaagcgattcgagatc aaaaagtggaacgctgtcgctctttgggcttgggatattgtcgtggataactgtgcgatt tgcaggaaccatatcatggatctctgcatcgagtgccaagctaaccaagcgagtgccacc agcgaggaatgtactgttgcttggggggtctgcaaccatgcatttcacttccactgcatc agcagatggctcaagactcgtcaagtttgtccgctagataacagcgagtgggaatttcag aagtatggtcactaa

DBGET integrated database retrieval system