Camelus ferus (Wild Bactrian camel): 102508092 Help Entry 102508092         CDS       T02979                                  Symbol CD209 Name (RefSeq) CD209 antigen   KO K06563   C-type lectin domain family 4 member L/M Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr03260   Virion - Human immunodeficiency virus cfr03264   Virion - Flavivirus and Alphavirus cfr03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus cfr03273   Virion - Lassa virus and SFTS virus cfr04145   Phagosome cfr04625   C-type lectin receptor signaling pathway cfr05152   Tuberculosis cfr05162   Measles Brite KEGG Orthology (KO) [BR:cfr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     102508092 (CD209)    03264 Virion - Flavivirus and Alphavirus     102508092 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     102508092 (CD209)    03273 Virion - Lassa virus and SFTS virus     102508092 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102508092 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102508092 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     102508092 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     102508092 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102508092 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:cfr04054]     102508092 (CD209)    04515 Cell adhesion molecules [BR:cfr04515]     102508092 (CD209)    04090 CD molecules [BR:cfr04090]     102508092 (CD209)    04091 Lectins [BR:cfr04091]     102508092 (CD209) Membrane trafficking [BR:cfr04131]  Endocytosis   Phagocytosis    C-lectin receptors     102508092 (CD209) Pattern recognition receptors [BR:cfr04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    102508092 (CD209) Cell adhesion molecules [BR:cfr04515]  Lectins   Selectins and C-type lectins    102508092 (CD209) CD molecules [BR:cfr04090]  Proteins   102508092 (CD209) Lectins [BR:cfr04091]  C-Type lectins   Asialoglycoprotein and DC receptors    102508092 (CD209) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C OAD_gamma Motif Other DBs NCBI-GeneID:  102508092 NCBI-ProteinID:  XP_006177629 UniProt:  A0A8B6Y8Q7 LinkDB All DBs Position 22:22224864..22228186 Genome browser AA seq 249 aa AA seqDB search MAEMSDPREPDGSEEENFGGKRLTGKDPGQLCSWRSLPGCLTRAPLLLFLVFISLGFLML LVTTMVQVSRIDQSLQKETRDDQESHNPVAVAQEQMQSKLEGIRQQLTWMNATLASLCHP CPWNWEVFQGNCYLFSWTQSDWKSAVSACRNIKAQLVIVSSAEEQKFLKFWYVRNNKPTW IGLSDHHNEGSWRWLDNSSLQLSFWKDGEPNNHGDEDCVELHNDGWNDGRCVTEHSWICE KPSTPCPEL NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atggcagagatgtctgaccccagggagccagatggctctgaggaggagaattttgggggc aagagactgactgggaaagaccctggacaactctgcagttggaggagcttgccagggtgt ctgacccgggcccctctgcttctgttcctggttttcatctcactgggtttccttatgctc ctggtgaccaccatggttcaagtctccaggattgaccagtccctgcagaaagagacaagg gacgatcaggagagccacaacccggttgctgtcgcacaggagcagatgcaatcaaagctg gaaggaatccggcagcagctgacctggatgaatgccaccctggctagcctgtgccatcct tgcccctggaattgggaagtcttccaggggaattgttacttattctcctggacccagagt gactggaaatctgccgtctctgcctgtcggaacattaaggcccaactagtgatcgtcagc agtgctgaagagcagaaattcctgaagttttggtatgtcagaaataataagcccacttgg atcggcctcagtgaccaccacaatgagggttcctggcggtggctggacaacagctccctc caactcagcttctggaaagatggggaacccaacaaccacggagatgaggactgtgtggaa ttacacaatgatggctggaatgatggcagatgtgttacagaacactcctggatctgtgag aagccctcaactccctgccctgaactctga

DBGET integrated database retrieval system