Camelus ferus (Wild Bactrian camel): 102513411 Help Entry 102513411         CDS       T02979                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04151   PI3K-Akt signaling pathway cfr04217   Necroptosis cfr04380   Osteoclast differentiation cfr04620   Toll-like receptor signaling pathway cfr04621   NOD-like receptor signaling pathway cfr04622   RIG-I-like receptor signaling pathway cfr04623   Cytosolic DNA-sensing pathway cfr04630   JAK-STAT signaling pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04668   TNF signaling pathway cfr04936   Alcoholic liver disease cfr05135   Yersinia infection cfr05142   Chagas disease cfr05152   Tuberculosis cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05162   Measles cfr05163   Human cytomegalovirus infection cfr05164   Influenza A cfr05165   Human papillomavirus infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05168   Herpes simplex virus 1 infection cfr05169   Epstein-Barr virus infection cfr05170   Human immunodeficiency virus 1 infection cfr05171   Coronavirus disease - COVID-19 cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102513411 (IFNB1)    04668 TNF signaling pathway     102513411 (IFNB1)    04151 PI3K-Akt signaling pathway     102513411 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102513411 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102513411 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102513411 (IFNB1)    04621 NOD-like receptor signaling pathway     102513411 (IFNB1)    04622 RIG-I-like receptor signaling pathway     102513411 (IFNB1)    04623 Cytosolic DNA-sensing pathway     102513411 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     102513411 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     102513411 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102513411 (IFNB1)    05161 Hepatitis B     102513411 (IFNB1)    05160 Hepatitis C     102513411 (IFNB1)    05171 Coronavirus disease - COVID-19     102513411 (IFNB1)    05164 Influenza A     102513411 (IFNB1)    05162 Measles     102513411 (IFNB1)    05168 Herpes simplex virus 1 infection     102513411 (IFNB1)    05163 Human cytomegalovirus infection     102513411 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     102513411 (IFNB1)    05169 Epstein-Barr virus infection     102513411 (IFNB1)    05165 Human papillomavirus infection     102513411 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     102513411 (IFNB1)    05152 Tuberculosis     102513411 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     102513411 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102513411 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102513411 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102513411 (IFNB1) Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Interferons    102513411 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Benyvirus_14KDa Motif Other DBs NCBI-GeneID:  102513411 NCBI-ProteinID:  XP_006180434 UniProt:  S9X1D4 LinkDB All DBs Position 4:17623824..17624384 Genome browser AA seq 186 aa AA seqDB search MIDRCILQIALLLCFSTTALSVNYNLLRYQQRSSNLACKNLLRQMPGIPQYCLKDRMDFD VPEEIKQPQQFQKEDAVLVIYEMLQQIFGIFRRDFSSTGWNKAIIEDLLVEIDVRIDHVE TILAEIMKEKNFTRGDMTILHLRMYYLKIVQYLKSKEYSGCAWTVVQAEILRNFSFLNSL TECLQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgatcgacaggtgcatcctccaaatcgctctcctattgtgtttctccaccacagctctt tccgtgaactacaacttgcttcggtaccaacaaaggagcagcaacttggcatgtaagaat ctcctgcggcagatgcctggaatccctcagtattgcctcaaggacaggatggactttgac gtccctgaggagattaagcaaccccagcagttccagaaggaagatgccgtattggtcatc tatgagatgctccagcagatctttggtattttcagaagagatttctcaagcactggctgg aataaggccatcattgaggatctccttgtagaaatcgatgtgcggatagaccatgtggag acaatcctggcggaaataatgaaggagaaaaacttcaccaggggagacatgaccatcctt cacctaaggatgtattacttaaagatcgtgcagtacttgaagtccaaggaatacagcggc tgtgcctggacagtagtccaagcggaaatcctcaggaatttttccttccttaacagtctt acagaatgccttcaggactga

DBGET integrated database retrieval system