Camelus ferus (Wild Bactrian camel): 102515500 Help Entry 102515500         CDS       T02979                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X2   KO K05430   interleukin 4 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04151   PI3K-Akt signaling pathway cfr04630   JAK-STAT signaling pathway cfr04640   Hematopoietic cell lineage cfr04657   IL-17 signaling pathway cfr04658   Th1 and Th2 cell differentiation cfr04659   Th17 cell differentiation cfr04660   T cell receptor signaling pathway cfr04664   Fc epsilon RI signaling pathway cfr04672   Intestinal immune network for IgA production cfr05140   Leishmaniasis cfr05200   Pathways in cancer cfr05310   Asthma cfr05320   Autoimmune thyroid disease cfr05321   Inflammatory bowel disease cfr05330   Allograft rejection Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102515500 (IL4)    04151 PI3K-Akt signaling pathway     102515500 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102515500 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102515500 (IL4)    04660 T cell receptor signaling pathway     102515500 (IL4)    04658 Th1 and Th2 cell differentiation     102515500 (IL4)    04659 Th17 cell differentiation     102515500 (IL4)    04657 IL-17 signaling pathway     102515500 (IL4)    04664 Fc epsilon RI signaling pathway     102515500 (IL4)    04672 Intestinal immune network for IgA production     102515500 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102515500 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102515500 (IL4)   09163 Immune disease    05310 Asthma     102515500 (IL4)    05320 Autoimmune thyroid disease     102515500 (IL4)    05321 Inflammatory bowel disease     102515500 (IL4)    05330 Allograft rejection     102515500 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102515500 (IL4)    00536 Glycosaminoglycan binding proteins [BR:cfr00536]     102515500 (IL4) Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Interleukins    102515500 (IL4) Glycosaminoglycan binding proteins [BR:cfr00536]  Heparan sulfate / Heparin   Cytokines    102515500 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 DUF4942 AAR2 SecIII_SopE_N Motif Other DBs NCBI-GeneID:  102515500 NCBI-ProteinID:  XP_006179658 UniProt:  A0A8B6YAV2 LinkDB All DBs Position 3:92014271..92022575 Genome browser AA seq 133 aa AA seqDB search MGLTYQLIPTLVCLLVCTSNFAHGHKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAP KNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLE RLKKIMKEKYSKC NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacttaccaactgatcccaaccctggtctgcttactggtttgtaccagcaac tttgcccacggacacaagtgtgatatcaccttgcaagagatcatcaaaacgctgaacacc ctcactgcgagaaagaattcgtgcatggagctgactgtagcagacgtctttgctgcccca aagaacacgactgagaaggaaaccttctgcaaggcggcaactgctcttcggcacatctac agacaccacaactgcttgagcaaacacctgagcggacttgacaggaacctcagcggcctg gcaaacacgacctgttctgtgaatgactccaagaagagcacattgagagacttcttggaa aggctaaagaagattatgaaggagaaatactcaaaatgttga

DBGET integrated database retrieval system