Camelus ferus (Wild Bactrian camel): 102519397 Help Entry 102519397         CDS       T02979                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01522   Endocrine resistance cfr04010   MAPK signaling pathway cfr04024   cAMP signaling pathway cfr04210   Apoptosis cfr04380   Osteoclast differentiation cfr04620   Toll-like receptor signaling pathway cfr04657   IL-17 signaling pathway cfr04658   Th1 and Th2 cell differentiation cfr04659   Th17 cell differentiation cfr04660   T cell receptor signaling pathway cfr04662   B cell receptor signaling pathway cfr04668   TNF signaling pathway cfr04713   Circadian entrainment cfr04725   Cholinergic synapse cfr04728   Dopaminergic synapse cfr04915   Estrogen signaling pathway cfr04917   Prolactin signaling pathway cfr04921   Oxytocin signaling pathway cfr04926   Relaxin signaling pathway cfr04928   Parathyroid hormone synthesis, secretion and action cfr04932   Non-alcoholic fatty liver disease cfr04935   Growth hormone synthesis, secretion and action cfr05031   Amphetamine addiction cfr05132   Salmonella infection cfr05133   Pertussis cfr05135   Yersinia infection cfr05140   Leishmaniasis cfr05142   Chagas disease cfr05161   Hepatitis B cfr05162   Measles cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05170   Human immunodeficiency virus 1 infection cfr05171   Coronavirus disease - COVID-19 cfr05200   Pathways in cancer cfr05207   Chemical carcinogenesis - receptor activation cfr05208   Chemical carcinogenesis - reactive oxygen species cfr05210   Colorectal cancer cfr05224   Breast cancer cfr05231   Choline metabolism in cancer cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cfr05323   Rheumatoid arthritis cfr05417   Lipid and atherosclerosis cfr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102519397 (FOS)    04668 TNF signaling pathway     102519397 (FOS)    04024 cAMP signaling pathway     102519397 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102519397 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102519397 (FOS)    04660 T cell receptor signaling pathway     102519397 (FOS)    04658 Th1 and Th2 cell differentiation     102519397 (FOS)    04659 Th17 cell differentiation     102519397 (FOS)    04657 IL-17 signaling pathway     102519397 (FOS)    04662 B cell receptor signaling pathway     102519397 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     102519397 (FOS)    04917 Prolactin signaling pathway     102519397 (FOS)    04921 Oxytocin signaling pathway     102519397 (FOS)    04926 Relaxin signaling pathway     102519397 (FOS)    04935 Growth hormone synthesis, secretion and action     102519397 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     102519397 (FOS)   09156 Nervous system    04725 Cholinergic synapse     102519397 (FOS)    04728 Dopaminergic synapse     102519397 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     102519397 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     102519397 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102519397 (FOS)    05207 Chemical carcinogenesis - receptor activation     102519397 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     102519397 (FOS)    05231 Choline metabolism in cancer     102519397 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102519397 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     102519397 (FOS)    05224 Breast cancer     102519397 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102519397 (FOS)    05170 Human immunodeficiency virus 1 infection     102519397 (FOS)    05161 Hepatitis B     102519397 (FOS)    05171 Coronavirus disease - COVID-19     102519397 (FOS)    05162 Measles     102519397 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     102519397 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102519397 (FOS)    05135 Yersinia infection     102519397 (FOS)    05133 Pertussis     102519397 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102519397 (FOS)    05142 Chagas disease     102519397 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     102519397 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     102519397 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102519397 (FOS)    05418 Fluid shear stress and atherosclerosis     102519397 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102519397 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102519397 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cfr03000]     102519397 (FOS)    04131 Membrane trafficking [BR:cfr04131]     102519397 (FOS) Transcription factors [BR:cfr03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     102519397 (FOS) Membrane trafficking [BR:cfr04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102519397 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  102519397 NCBI-ProteinID:  XP_006184529 UniProt:  S9YBE9 LinkDB All DBs Position 6:70586369..70589790 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSTGAYPRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPAKSSSSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggatttctgtaccgatctggccgtctccagtgccaacttc atcccaacagtgacggccatctcgaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagctccccacccctatggagtccccact ccctcgactggggcttaccccagggctggagtcgtgaagactatgacaggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggagacagaccaattagaagatgagaagtccgctttgcag actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcat cgacctgcctgcaagatccctgatgacctgggtttcccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgcctgaggctgccaccccagaatccgaggaggccttcacc ctgcccctcctaaatgaccctgagcccaagccctcagtggagcccgccaagagctccagc agcatggagctgaaggctgagccctttgatgacttcttgttcccagcatcttccaggccc agcggctctgagaccgcacgttctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggttccctggggatggggcccatggccacagagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtctttacctaccccgaggctgactccttccccagctgtgcagctgctcaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system