Camelus ferus (Wild Bactrian camel): 102524037 Help Entry 102524037         CDS       T02979                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04010   MAPK signaling pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04024   cAMP signaling pathway cfr04062   Chemokine signaling pathway cfr04510   Focal adhesion cfr04520   Adherens junction cfr04611   Platelet activation cfr04670   Leukocyte transendothelial migration cfr04720   Long-term potentiation cfr04722   Neurotrophin signaling pathway cfr04934   Cushing syndrome cfr04972   Pancreatic secretion cfr05211   Renal cell carcinoma cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102524037 (RAP1B)    04014 Ras signaling pathway     102524037 (RAP1B)    04015 Rap1 signaling pathway     102524037 (RAP1B)    04024 cAMP signaling pathway     102524037 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102524037 (RAP1B)    04520 Adherens junction     102524037 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102524037 (RAP1B)    04670 Leukocyte transendothelial migration     102524037 (RAP1B)    04062 Chemokine signaling pathway     102524037 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     102524037 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     102524037 (RAP1B)    04722 Neurotrophin signaling pathway     102524037 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     102524037 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102524037 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102524037 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102524037 (RAP1B)    04031 GTP-binding proteins [BR:cfr04031]     102524037 (RAP1B) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102524037 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    102524037 (RAP1B)   Exosomal proteins of colorectal cancer cells    102524037 (RAP1B) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     102524037 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  102524037 NCBI-ProteinID:  XP_032349254 UniProt:  A0A8B8U3T8 LinkDB All DBs Position 12:35515551..35556139 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacaatttgttcaaggaatttttgttgaaaaatacgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctcagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagtggtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcgaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system