Chlamydia trachomatis F/SW4: FSW4_6231 Help Entry FSW4_6231         CDS       T02165                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism cfs  Chlamydia trachomatis F/SW4 Pathway cfs00670   One carbon pool by folate cfs00790   Folate biosynthesis cfs01100   Metabolic pathways cfs01240   Biosynthesis of cofactors cfs04981   Folate transport and metabolism Module cfs_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:cfs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FSW4_6231 (folA)    00670 One carbon pool by folate     FSW4_6231 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     FSW4_6231 (folA) Enzymes [BR:cfs01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      FSW4_6231 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CCE13785 LinkDB All DBs Position complement(692598..693077) Genome browser AA seq 159 aa AA seqDB search MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKE YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaaggaa tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system