Cricetulus griseus (Chinese hamster): 100689186 Help Entry 100689186         CDS       T02813                                  Symbol Il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge01521   EGFR tyrosine kinase inhibitor resistance cge01523   Antifolate resistance cge04060   Cytokine-cytokine receptor interaction cge04061   Viral protein interaction with cytokine and cytokine receptor cge04066   HIF-1 signaling pathway cge04068   FoxO signaling pathway cge04151   PI3K-Akt signaling pathway cge04218   Cellular senescence cge04620   Toll-like receptor signaling pathway cge04621   NOD-like receptor signaling pathway cge04623   Cytosolic DNA-sensing pathway cge04625   C-type lectin receptor signaling pathway cge04630   JAK-STAT signaling pathway cge04640   Hematopoietic cell lineage cge04657   IL-17 signaling pathway cge04659   Th17 cell differentiation cge04668   TNF signaling pathway cge04672   Intestinal immune network for IgA production cge04931   Insulin resistance cge04932   Non-alcoholic fatty liver disease cge04933   AGE-RAGE signaling pathway in diabetic complications cge04936   Alcoholic liver disease cge05010   Alzheimer disease cge05020   Prion disease cge05022   Pathways of neurodegeneration - multiple diseases cge05132   Salmonella infection cge05133   Pertussis cge05134   Legionellosis cge05135   Yersinia infection cge05142   Chagas disease cge05143   African trypanosomiasis cge05144   Malaria cge05146   Amoebiasis cge05152   Tuberculosis cge05161   Hepatitis B cge05162   Measles cge05163   Human cytomegalovirus infection cge05164   Influenza A cge05166   Human T-cell leukemia virus 1 infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05168   Herpes simplex virus 1 infection cge05169   Epstein-Barr virus infection cge05171   Coronavirus disease - COVID-19 cge05200   Pathways in cancer cge05202   Transcriptional misregulation in cancer cge05321   Inflammatory bowel disease cge05323   Rheumatoid arthritis cge05332   Graft-versus-host disease cge05410   Hypertrophic cardiomyopathy cge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100689186 (Il6)    04668 TNF signaling pathway     100689186 (Il6)    04066 HIF-1 signaling pathway     100689186 (Il6)    04068 FoxO signaling pathway     100689186 (Il6)    04151 PI3K-Akt signaling pathway     100689186 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100689186 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     100689186 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100689186 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100689186 (Il6)    04620 Toll-like receptor signaling pathway     100689186 (Il6)    04621 NOD-like receptor signaling pathway     100689186 (Il6)    04623 Cytosolic DNA-sensing pathway     100689186 (Il6)    04625 C-type lectin receptor signaling pathway     100689186 (Il6)    04659 Th17 cell differentiation     100689186 (Il6)    04657 IL-17 signaling pathway     100689186 (Il6)    04672 Intestinal immune network for IgA production     100689186 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100689186 (Il6)    05202 Transcriptional misregulation in cancer     100689186 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100689186 (Il6)    05161 Hepatitis B     100689186 (Il6)    05171 Coronavirus disease - COVID-19     100689186 (Il6)    05164 Influenza A     100689186 (Il6)    05162 Measles     100689186 (Il6)    05168 Herpes simplex virus 1 infection     100689186 (Il6)    05163 Human cytomegalovirus infection     100689186 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     100689186 (Il6)    05169 Epstein-Barr virus infection     100689186 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     100689186 (Il6)    05135 Yersinia infection     100689186 (Il6)    05133 Pertussis     100689186 (Il6)    05134 Legionellosis     100689186 (Il6)    05152 Tuberculosis     100689186 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     100689186 (Il6)    05144 Malaria     100689186 (Il6)    05142 Chagas disease     100689186 (Il6)    05143 African trypanosomiasis     100689186 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     100689186 (Il6)    05321 Inflammatory bowel disease     100689186 (Il6)    05332 Graft-versus-host disease     100689186 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     100689186 (Il6)    05020 Prion disease     100689186 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     100689186 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100689186 (Il6)    05410 Hypertrophic cardiomyopathy     100689186 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100689186 (Il6)    04932 Non-alcoholic fatty liver disease     100689186 (Il6)    04931 Insulin resistance     100689186 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     100689186 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100689186 (Il6)    01523 Antifolate resistance     100689186 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100689186 (Il6) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Interleukins    100689186 (Il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 Motif Other DBs NCBI-GeneID:  100689186 NCBI-ProteinID:  XP_027285369 UniProt:  A0A3L7H8J5 LinkDB All DBs Position 8:complement(92711892..92716331) Genome browser AA seq 212 aa AA seqDB search MKFLSARDFHPLAFLGLMLAVATALPTSQVRRGDFTEDTTPNRPVYTTSQQVGGLVTHVL REIFELRKELCNNNPDCMNYDDALLENNLELPVIQRNDGCYQTGYNWEICLLKITSGLLD YQIYLEFVTNNVQDNKKDKARVIQSTTKTLSQIFKQEVKDPDKIVMPSPTSKAILIEKLE SQKQWPRTKTIELILKALEEFLKVTMRSTRQN NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgaagttcctctccgcaagagacttccatccacttgccttcttgggactcatgctggcg gtggccactgccctccctacctcacaagttcggagaggagacttcacagaagacaccact cccaacagaccagtatatactacttcacaacaagtcggaggtttggttacacatgtgctc agggaaatcttcgaattgagaaaagagttgtgtaataacaatcctgattgtatgaactat gatgatgcattgttagaaaacaatctggaacttccggtgatacaaagaaatgatggctgc taccaaactggatacaattgggaaatttgcctactgaaaatcacctctggtcttctggac taccagatctacttggagtttgtgaccaacaatgtacaagataacaagaaagacaaagca agagtcattcagagcaccaccaaaaccctaagtcagatcttcaaacaagaggtaaaggat ccagataaaatagtcatgcctagcccaacttccaaggccatcctaatagagaagctggag tcacagaagcagtggccaaggaccaagaccatcgaactcatcctgaaagcacttgaagaa ttcctaaaagtcaccatgaggtctactcggcaaaactag

DBGET integrated database retrieval system