Cricetulus griseus (Chinese hamster): 100689418 Help Entry 100689418         CDS       T02813                                  Symbol Fos Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge01522   Endocrine resistance cge04010   MAPK signaling pathway cge04024   cAMP signaling pathway cge04210   Apoptosis cge04380   Osteoclast differentiation cge04620   Toll-like receptor signaling pathway cge04657   IL-17 signaling pathway cge04658   Th1 and Th2 cell differentiation cge04659   Th17 cell differentiation cge04660   T cell receptor signaling pathway cge04662   B cell receptor signaling pathway cge04668   TNF signaling pathway cge04713   Circadian entrainment cge04725   Cholinergic synapse cge04728   Dopaminergic synapse cge04915   Estrogen signaling pathway cge04917   Prolactin signaling pathway cge04921   Oxytocin signaling pathway cge04926   Relaxin signaling pathway cge04928   Parathyroid hormone synthesis, secretion and action cge04932   Non-alcoholic fatty liver disease cge04935   Growth hormone synthesis, secretion and action cge05031   Amphetamine addiction cge05132   Salmonella infection cge05133   Pertussis cge05135   Yersinia infection cge05140   Leishmaniasis cge05142   Chagas disease cge05161   Hepatitis B cge05162   Measles cge05166   Human T-cell leukemia virus 1 infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05170   Human immunodeficiency virus 1 infection cge05171   Coronavirus disease - COVID-19 cge05200   Pathways in cancer cge05207   Chemical carcinogenesis - receptor activation cge05208   Chemical carcinogenesis - reactive oxygen species cge05210   Colorectal cancer cge05224   Breast cancer cge05231   Choline metabolism in cancer cge05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cge05323   Rheumatoid arthritis cge05417   Lipid and atherosclerosis cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100689418 (Fos)    04668 TNF signaling pathway     100689418 (Fos)    04024 cAMP signaling pathway     100689418 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100689418 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100689418 (Fos)    04660 T cell receptor signaling pathway     100689418 (Fos)    04658 Th1 and Th2 cell differentiation     100689418 (Fos)    04659 Th17 cell differentiation     100689418 (Fos)    04657 IL-17 signaling pathway     100689418 (Fos)    04662 B cell receptor signaling pathway     100689418 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     100689418 (Fos)    04917 Prolactin signaling pathway     100689418 (Fos)    04921 Oxytocin signaling pathway     100689418 (Fos)    04926 Relaxin signaling pathway     100689418 (Fos)    04935 Growth hormone synthesis, secretion and action     100689418 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     100689418 (Fos)   09156 Nervous system    04725 Cholinergic synapse     100689418 (Fos)    04728 Dopaminergic synapse     100689418 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     100689418 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     100689418 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100689418 (Fos)    05207 Chemical carcinogenesis - receptor activation     100689418 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     100689418 (Fos)    05231 Choline metabolism in cancer     100689418 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100689418 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     100689418 (Fos)    05224 Breast cancer     100689418 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100689418 (Fos)    05170 Human immunodeficiency virus 1 infection     100689418 (Fos)    05161 Hepatitis B     100689418 (Fos)    05171 Coronavirus disease - COVID-19     100689418 (Fos)    05162 Measles     100689418 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     100689418 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     100689418 (Fos)    05135 Yersinia infection     100689418 (Fos)    05133 Pertussis     100689418 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100689418 (Fos)    05142 Chagas disease     100689418 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     100689418 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     100689418 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100689418 (Fos)    05418 Fluid shear stress and atherosclerosis     100689418 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100689418 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100689418 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cge03000]     100689418 (Fos)    04131 Membrane trafficking [BR:cge04131]     100689418 (Fos) Transcription factors [BR:cge03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100689418 (Fos) Membrane trafficking [BR:cge04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100689418 (Fos) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 Macoilin HALZ Motif Other DBs NCBI-GeneID:  100689418 NCBI-ProteinID:  NP_001233612 UniProt:  Q9Z2Q8 LinkDB All DBs Position 5:complement(118313605..118316055) Genome browser AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCADLSGSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAAMVKTVSGGRA QSISRRSKVEQLSPEEEEKRRIRRERNKMAAAKCWNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEATTPESEEAFS LPLLNDAEPKTSLEPVKSISNMELKAEPFDDFLFPPSSRPSGSETTARSVPDMDLSGSFY AADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgct tccccggccggggacagcctgtcctactatcattccccagccgactccttctccagcatg ggctcccctgtcaacgcacaggacttctgcgcagatctgtccggctccagtgccaacttt atccccaccgtgacagccatctccaccagcccagacctacagtggctggtgcagcccacc ctggtctcctccgtggccccatcgcagaccagagcgccccatccctacggagtccccacc ccttcggctggggcttactccagggccgcaatggtgaagaccgtgtcaggcggcagagcg cagagcatcagcagaagaagcaaagtagagcagttatctcctgaagaggaagagaaacgg agaatccgaagggaaaggaataagatggctgcagccaaatgctggaatcggaggagggaa ctgactgatactctccaagcggagacagaccaacttgaagacgagaagtctgcattgcag actgagattgccaatctgctcaaagagaaggagaaactggagttcattttggcagcccac cgacctgcttgcaagatcccggatgacctgggcttcccagaagagatgtctgtggcttcc ctggatttgactgggggtctgcctgaggccactaccccagagtccgaggaggccttctca ctgcctcttctcaatgacgctgagcccaagacatcactggagccagtcaagagcatcagc aatatggagctgaaggctgagccctttgatgacttcttgttcccaccatcatccaggccc agtggctctgagacgacggccagatctgtgccagacatggacctatccggttccttctac gcagcagactgggagcctctgcacagtagctccctggggatggggcccatggtcacagag ctggagcccctgtgtaccccggtggtcacctgtactcccagctgcacaacttacacgtct tcctttgtcttcacctaccccgaggctgactccttccccagctgtgcagctgcccaccga aagggcagcagcagcaacgagccctcctctgactcactgagctcacccacactgctagcc ctgtga

DBGET integrated database retrieval system