Cricetulus griseus (Chinese hamster): 100689477 Help Entry 100689477         CDS       T02813                                  Symbol Actb Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge03082   ATP-dependent chromatin remodeling cge04015   Rap1 signaling pathway cge04145   Phagosome cge04210   Apoptosis cge04390   Hippo signaling pathway cge04510   Focal adhesion cge04520   Adherens junction cge04530   Tight junction cge04611   Platelet activation cge04613   Neutrophil extracellular trap formation cge04670   Leukocyte transendothelial migration cge04714   Thermogenesis cge04810   Regulation of actin cytoskeleton cge04814   Motor proteins cge04820   Cytoskeleton in muscle cells cge04919   Thyroid hormone signaling pathway cge04921   Oxytocin signaling pathway cge04971   Gastric acid secretion cge05014   Amyotrophic lateral sclerosis cge05100   Bacterial invasion of epithelial cells cge05132   Salmonella infection cge05135   Yersinia infection cge05164   Influenza A cge05205   Proteoglycans in cancer cge05225   Hepatocellular carcinoma cge05410   Hypertrophic cardiomyopathy cge05412   Arrhythmogenic right ventricular cardiomyopathy cge05414   Dilated cardiomyopathy cge05416   Viral myocarditis cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100689477 (Actb)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100689477 (Actb)    04390 Hippo signaling pathway     100689477 (Actb)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100689477 (Actb)   09143 Cell growth and death    04210 Apoptosis     100689477 (Actb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100689477 (Actb)    04520 Adherens junction     100689477 (Actb)    04530 Tight junction     100689477 (Actb)   09142 Cell motility    04814 Motor proteins     100689477 (Actb)    04820 Cytoskeleton in muscle cells     100689477 (Actb)    04810 Regulation of actin cytoskeleton     100689477 (Actb)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100689477 (Actb)    04613 Neutrophil extracellular trap formation     100689477 (Actb)    04670 Leukocyte transendothelial migration     100689477 (Actb)   09152 Endocrine system    04921 Oxytocin signaling pathway     100689477 (Actb)    04919 Thyroid hormone signaling pathway     100689477 (Actb)   09154 Digestive system    04971 Gastric acid secretion     100689477 (Actb)   09159 Environmental adaptation    04714 Thermogenesis     100689477 (Actb)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100689477 (Actb)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100689477 (Actb)   09172 Infectious disease: viral    05164 Influenza A     100689477 (Actb)   09171 Infectious disease: bacterial    05132 Salmonella infection     100689477 (Actb)    05135 Yersinia infection     100689477 (Actb)    05100 Bacterial invasion of epithelial cells     100689477 (Actb)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100689477 (Actb)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100689477 (Actb)    05410 Hypertrophic cardiomyopathy     100689477 (Actb)    05412 Arrhythmogenic right ventricular cardiomyopathy     100689477 (Actb)    05414 Dilated cardiomyopathy     100689477 (Actb)    05416 Viral myocarditis     100689477 (Actb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cge03021]     100689477 (Actb)    03019 Messenger RNA biogenesis [BR:cge03019]     100689477 (Actb)    03036 Chromosome and associated proteins [BR:cge03036]     100689477 (Actb)    03029 Mitochondrial biogenesis [BR:cge03029]     100689477 (Actb)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cge04812]     100689477 (Actb)    04147 Exosome [BR:cge04147]     100689477 (Actb) Transcription machinery [BR:cge03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100689477 (Actb) Messenger RNA biogenesis [BR:cge03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100689477 (Actb) Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100689477 (Actb)     NuA4 complex      100689477 (Actb)   Chromatin remodeling factors    BAF complex     100689477 (Actb)    PBAF complex     100689477 (Actb)    GBAF(ncBAF) complex     100689477 (Actb)    SWR1 complex     100689477 (Actb) Mitochondrial biogenesis [BR:cge03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100689477 (Actb) Cytoskeleton proteins [BR:cge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100689477 (Actb) Exosome [BR:cge04147]  Exosomal proteins   Proteins found in most exosomes    100689477 (Actb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100689477 NCBI-ProteinID:  NP_001231504 UniProt:  P48975 LinkDB All DBs Position 4:complement(79470799..79472684) Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQEMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgacgatatcgctgcgctcgttgtcgacaacggctccggcatgtgcaaagccggc ttcgcgggcgacgatgctccccgggccgtcttcccatccatcgtgggccgccctaggcac cagggcgtgatggtgggcatgggccagaaggactcctacgtgggtgacgaggcccagagc aagagaggtattctgaccctgaagtaccccattgaacacggcattgtcaccaactgggac gatatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag caccctgtgctgctcaccgaggcccccctgaaccccaaggccaaccgtgaaaagatgacc cagatcatgtttgagaccttcaacaccccagccatgtacgtagccattcaggctgtgctg tccctgtatgcctctggtcgtaccactggcattgtgatggactccggagacggggtcacc cacactgtgcccatctatgagggctacgctctccctcatgccatcctgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctgaccgagcgtggctacagcttt accaccacagctgagagggaaattgtgcgtgacatcaaagagaagctgtgctatgttgcc ctggacttcgagcaggagatggccactgctgcatcctcttcctccctggagaagagctat gagctgcctgatggccaggtcatcaccattggcaatgagcggttccgttgccctgaggct cttttccagccttccttcctgggtatggaatcctgtggcatccacgaaactacattcaat tccatcatgaagtgtgacgtcgacatccgcaaagacctctatgccaacacagtgctgtct ggtggtaccaccatgtacccaggcattgctgaccggatgcagaaggagatcactgctctg gctcccagcaccatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtgg atcggtggctccatcctggcctcactgtccaccttccaggagatgtggatcagcaagcag gagtacgatgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system