Cricetulus griseus (Chinese hamster): 100755642 Help Entry 100755642         CDS       T02813                                  Symbol Il4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04060   Cytokine-cytokine receptor interaction cge04151   PI3K-Akt signaling pathway cge04630   JAK-STAT signaling pathway cge04640   Hematopoietic cell lineage cge04657   IL-17 signaling pathway cge04658   Th1 and Th2 cell differentiation cge04659   Th17 cell differentiation cge04660   T cell receptor signaling pathway cge04664   Fc epsilon RI signaling pathway cge04672   Intestinal immune network for IgA production cge05140   Leishmaniasis cge05200   Pathways in cancer cge05310   Asthma cge05320   Autoimmune thyroid disease cge05321   Inflammatory bowel disease cge05330   Allograft rejection Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100755642 (Il4)    04151 PI3K-Akt signaling pathway     100755642 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100755642 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100755642 (Il4)    04660 T cell receptor signaling pathway     100755642 (Il4)    04658 Th1 and Th2 cell differentiation     100755642 (Il4)    04659 Th17 cell differentiation     100755642 (Il4)    04657 IL-17 signaling pathway     100755642 (Il4)    04664 Fc epsilon RI signaling pathway     100755642 (Il4)    04672 Intestinal immune network for IgA production     100755642 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100755642 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100755642 (Il4)   09163 Immune disease    05310 Asthma     100755642 (Il4)    05320 Autoimmune thyroid disease     100755642 (Il4)    05321 Inflammatory bowel disease     100755642 (Il4)    05330 Allograft rejection     100755642 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100755642 (Il4)    00536 Glycosaminoglycan binding proteins [BR:cge00536]     100755642 (Il4) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Interleukins    100755642 (Il4) Glycosaminoglycan binding proteins [BR:cge00536]  Heparan sulfate / Heparin   Cytokines    100755642 (Il4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 mTOR_dom Motif Other DBs NCBI-GeneID:  100755642 NCBI-ProteinID:  XP_027282017 UniProt:  A0A8C2MG82 LinkDB All DBs Position 7:complement(67759352..67765753) Genome browser AA seq 147 aa AA seqDB search MGLRPQLAAILLCLLACTGNWTHGCHNGALKEIIHILNQVTLKGTPCTEMVVPDVLSARK NSTEKDLICKASQVLRKFYFPGEVTLCLKNNSRVLKDLRKLFRGISGLFPEKSCSVNEST YTTLRDFLESLIRIMRKKYWQCGSSAF NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggtctcaggccccagctagctgccatcctgctctgccttctagcatgtaccgggaac tggacccacggatgccacaacggagccttgaaagagatcatccacattttgaaccaggtc acattaaaagggacaccatgcaccgagatggtcgtaccagatgtcctttcagcaaggaag aactctacagagaaagacctcatctgcaaggcttcccaggtgcttcgcaaattttatttc ccaggtgaggtgactctgtgcttgaagaacaattccagggttctcaaagacctgagaaaa ctcttcaggggcatcagtggcctgtttccagagaagagctgcagtgtgaatgagtccacg tacacaacactgagagacttcttggaaagcctaataaggatcatgcgaaagaaatactgg cagtgtggaagttctgcgttttaa

DBGET integrated database retrieval system