Cricetulus griseus (Chinese hamster): 100764780 Help Entry 100764780         CDS       T02813                                  Symbol Tnf Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge01523   Antifolate resistance cge04010   MAPK signaling pathway cge04060   Cytokine-cytokine receptor interaction cge04061   Viral protein interaction with cytokine and cytokine receptor cge04064   NF-kappa B signaling pathway cge04071   Sphingolipid signaling pathway cge04150   mTOR signaling pathway cge04210   Apoptosis cge04217   Necroptosis cge04350   TGF-beta signaling pathway cge04380   Osteoclast differentiation cge04612   Antigen processing and presentation cge04620   Toll-like receptor signaling pathway cge04621   NOD-like receptor signaling pathway cge04622   RIG-I-like receptor signaling pathway cge04625   C-type lectin receptor signaling pathway cge04640   Hematopoietic cell lineage cge04650   Natural killer cell mediated cytotoxicity cge04657   IL-17 signaling pathway cge04660   T cell receptor signaling pathway cge04664   Fc epsilon RI signaling pathway cge04668   TNF signaling pathway cge04920   Adipocytokine signaling pathway cge04930   Type II diabetes mellitus cge04931   Insulin resistance cge04932   Non-alcoholic fatty liver disease cge04933   AGE-RAGE signaling pathway in diabetic complications cge04936   Alcoholic liver disease cge04940   Type I diabetes mellitus cge05010   Alzheimer disease cge05014   Amyotrophic lateral sclerosis cge05020   Prion disease cge05022   Pathways of neurodegeneration - multiple diseases cge05132   Salmonella infection cge05133   Pertussis cge05134   Legionellosis cge05135   Yersinia infection cge05140   Leishmaniasis cge05142   Chagas disease cge05143   African trypanosomiasis cge05144   Malaria cge05145   Toxoplasmosis cge05146   Amoebiasis cge05152   Tuberculosis cge05160   Hepatitis C cge05161   Hepatitis B cge05163   Human cytomegalovirus infection cge05164   Influenza A cge05165   Human papillomavirus infection cge05166   Human T-cell leukemia virus 1 infection cge05168   Herpes simplex virus 1 infection cge05169   Epstein-Barr virus infection cge05170   Human immunodeficiency virus 1 infection cge05171   Coronavirus disease - COVID-19 cge05205   Proteoglycans in cancer cge05310   Asthma cge05321   Inflammatory bowel disease cge05322   Systemic lupus erythematosus cge05323   Rheumatoid arthritis cge05330   Allograft rejection cge05332   Graft-versus-host disease cge05410   Hypertrophic cardiomyopathy cge05414   Dilated cardiomyopathy cge05417   Lipid and atherosclerosis cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100764780 (Tnf)    04350 TGF-beta signaling pathway     100764780 (Tnf)    04064 NF-kappa B signaling pathway     100764780 (Tnf)    04668 TNF signaling pathway     100764780 (Tnf)    04071 Sphingolipid signaling pathway     100764780 (Tnf)    04150 mTOR signaling pathway     100764780 (Tnf)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100764780 (Tnf)    04061 Viral protein interaction with cytokine and cytokine receptor     100764780 (Tnf)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100764780 (Tnf)    04217 Necroptosis     100764780 (Tnf)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100764780 (Tnf)    04620 Toll-like receptor signaling pathway     100764780 (Tnf)    04621 NOD-like receptor signaling pathway     100764780 (Tnf)    04622 RIG-I-like receptor signaling pathway     100764780 (Tnf)    04625 C-type lectin receptor signaling pathway     100764780 (Tnf)    04650 Natural killer cell mediated cytotoxicity     100764780 (Tnf)    04612 Antigen processing and presentation     100764780 (Tnf)    04660 T cell receptor signaling pathway     100764780 (Tnf)    04657 IL-17 signaling pathway     100764780 (Tnf)    04664 Fc epsilon RI signaling pathway     100764780 (Tnf)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100764780 (Tnf)   09158 Development and regeneration    04380 Osteoclast differentiation     100764780 (Tnf)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100764780 (Tnf)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100764780 (Tnf)    05170 Human immunodeficiency virus 1 infection     100764780 (Tnf)    05161 Hepatitis B     100764780 (Tnf)    05160 Hepatitis C     100764780 (Tnf)    05171 Coronavirus disease - COVID-19     100764780 (Tnf)    05164 Influenza A     100764780 (Tnf)    05168 Herpes simplex virus 1 infection     100764780 (Tnf)    05163 Human cytomegalovirus infection     100764780 (Tnf)    05169 Epstein-Barr virus infection     100764780 (Tnf)    05165 Human papillomavirus infection     100764780 (Tnf)   09171 Infectious disease: bacterial    05132 Salmonella infection     100764780 (Tnf)    05135 Yersinia infection     100764780 (Tnf)    05133 Pertussis     100764780 (Tnf)    05134 Legionellosis     100764780 (Tnf)    05152 Tuberculosis     100764780 (Tnf)   09174 Infectious disease: parasitic    05146 Amoebiasis     100764780 (Tnf)    05144 Malaria     100764780 (Tnf)    05145 Toxoplasmosis     100764780 (Tnf)    05140 Leishmaniasis     100764780 (Tnf)    05142 Chagas disease     100764780 (Tnf)    05143 African trypanosomiasis     100764780 (Tnf)   09163 Immune disease    05310 Asthma     100764780 (Tnf)    05322 Systemic lupus erythematosus     100764780 (Tnf)    05323 Rheumatoid arthritis     100764780 (Tnf)    05321 Inflammatory bowel disease     100764780 (Tnf)    05330 Allograft rejection     100764780 (Tnf)    05332 Graft-versus-host disease     100764780 (Tnf)   09164 Neurodegenerative disease    05010 Alzheimer disease     100764780 (Tnf)    05014 Amyotrophic lateral sclerosis     100764780 (Tnf)    05020 Prion disease     100764780 (Tnf)    05022 Pathways of neurodegeneration - multiple diseases     100764780 (Tnf)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100764780 (Tnf)    05418 Fluid shear stress and atherosclerosis     100764780 (Tnf)    05410 Hypertrophic cardiomyopathy     100764780 (Tnf)    05414 Dilated cardiomyopathy     100764780 (Tnf)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100764780 (Tnf)    04940 Type I diabetes mellitus     100764780 (Tnf)    04936 Alcoholic liver disease     100764780 (Tnf)    04932 Non-alcoholic fatty liver disease     100764780 (Tnf)    04931 Insulin resistance     100764780 (Tnf)    04933 AGE-RAGE signaling pathway in diabetic complications     100764780 (Tnf)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100764780 (Tnf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100764780 (Tnf)    00536 Glycosaminoglycan binding proteins [BR:cge00536]     100764780 (Tnf) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Tumor necrosis fators    100764780 (Tnf) Glycosaminoglycan binding proteins [BR:cge00536]  Heparan sulfate / Heparin   Cytokines    100764780 (Tnf) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  100764780 NCBI-ProteinID:  XP_027244471 UniProt:  G3HZG9 LinkDB All DBs Position 1 Genome browser AA seq 234 aa AA seqDB search MSTESMIRDVELAEEALPKKAWGPQNSSRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR EEKFPNNPIIGSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMS LKDNQLVIPADGLYLVYSQVLFTGQGCSNYVLLTHTVSRIAVSYEDKVNLLSAIKSPCPK ETPEGAELKPWYEPIYLGGVFQLEKGDRLSAEVNLPKYLDFAESGQVYFGVIAL NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgagcacagaaagcatgatccgcgacgtggagctggcagaggaggcactccccaaaaag gcgtggggcccccagaactccagccggtgcctatgtctcagcctcttctccttcctgctt gtggcaggggccaccaccctcttctgtctgctgaactttggagtgatcggcccccaaagg gaagagaagttcccgaacaaccctatcataggctccatggcccagacactcacactcagg tcatcttctcaaaattcgagtgacaagcctgtagcccacgttgtagcaaaccaccaagtg gaggagcagctggagtggctgagccagcgtgccaatgccctcctggccaacggcatgtct ctcaaagacaaccagctggtgattccagcggatgggctgtacctcgtctactcccaggtt ctcttcacgggccaaggctgctccaactacgtgctcctcacccacactgtcagccgcatt gctgtctcctacgaggataaagtcaacctcctgtctgccatcaagagcccctgccccaag gaaacccctgagggggcggagctcaagccctggtacgagcccatctacctgggaggggtc ttccagctggagaaaggcgaccgactgagtgccgaggtcaacctgcctaaatacttagat tttgcagaatccgggcaggtctactttggagtcatcgctctgtga

DBGET integrated database retrieval system