Cricetulus griseus (Chinese hamster): 100765177 Help Entry 100765177         CDS       T02813                                  Name (RefSeq) phospholipase A2   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge00564   Glycerophospholipid metabolism cge00565   Ether lipid metabolism cge00590   Arachidonic acid metabolism cge00591   Linoleic acid metabolism cge00592   alpha-Linolenic acid metabolism cge01100   Metabolic pathways cge04014   Ras signaling pathway cge04270   Vascular smooth muscle contraction cge04972   Pancreatic secretion cge04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:cge00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     100765177    00565 Ether lipid metabolism     100765177    00590 Arachidonic acid metabolism     100765177    00591 Linoleic acid metabolism     100765177    00592 alpha-Linolenic acid metabolism     100765177  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100765177  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     100765177   09154 Digestive system    04972 Pancreatic secretion     100765177    04975 Fat digestion and absorption     100765177  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100765177 Enzymes [BR:cge01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      100765177 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     100765177 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Motif Other DBs NCBI-GeneID:  100765177 NCBI-ProteinID:  XP_027271868 UniProt:  A0A9J7FZ00 LinkDB All DBs Position 4:complement(95052539..95056756) Genome browser AA seq 137 aa AA seqDB search MKLLLLVTLLTGATAHDVKRQVLWQFSNVMECTIQGSHPLKDYNTYSCFCGSYTPVDELD RCCKAQDHCYDQAKKLEICTFPHSPYTTPYSFSCSGNEVTCSDENDACEAFICNCDLQAA ICFSKASYTKKNKGIHC NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgaaactccttctgctagtcactctgctcacaggcgctacagcacacgatgtcaagcgt caggttctgtggcagttcagtaatgtgatggagtgcaccatccaagggagtcatcccttg aaggattacaacacctatagctgcttctgtggttcatacactccagtggatgagttagac aggtgctgcaaggctcaggaccactgctatgatcaggccaagaagctggaaatctgcaca ttcccacacagcccctacaccaccccctactcattctcatgctctgggaatgaggtcacc tgcagtgatgaaaatgatgcctgtgaggccttcatctgcaactgtgaccttcaggctgcc atctgcttctccaaggcttcatacaccaagaagaacaaagggattcactgttag

DBGET integrated database retrieval system