Cricetulus griseus (Chinese hamster): 100769542 Help Entry 100769542         CDS       T02813                                  Symbol Rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04010   MAPK signaling pathway cge04014   Ras signaling pathway cge04015   Rap1 signaling pathway cge04024   cAMP signaling pathway cge04062   Chemokine signaling pathway cge04510   Focal adhesion cge04517   IgSF CAM signaling cge04520   Adherens junction cge04611   Platelet activation cge04670   Leukocyte transendothelial migration cge04720   Long-term potentiation cge04722   Neurotrophin signaling pathway cge04934   Cushing syndrome cge04972   Pancreatic secretion cge05211   Renal cell carcinoma cge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100769542 (Rap1b)    04014 Ras signaling pathway     100769542 (Rap1b)    04015 Rap1 signaling pathway     100769542 (Rap1b)    04024 cAMP signaling pathway     100769542 (Rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100769542 (Rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100769542 (Rap1b)    04520 Adherens junction     100769542 (Rap1b)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100769542 (Rap1b)    04670 Leukocyte transendothelial migration     100769542 (Rap1b)    04062 Chemokine signaling pathway     100769542 (Rap1b)   09154 Digestive system    04972 Pancreatic secretion     100769542 (Rap1b)   09156 Nervous system    04720 Long-term potentiation     100769542 (Rap1b)    04722 Neurotrophin signaling pathway     100769542 (Rap1b)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     100769542 (Rap1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100769542 (Rap1b)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100769542 (Rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100769542 (Rap1b)    04031 GTP-binding proteins [BR:cge04031]     100769542 (Rap1b) Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100769542 (Rap1b)   Exosomal proteins of other body fluids (saliva and urine)    100769542 (Rap1b)   Exosomal proteins of colorectal cancer cells    100769542 (Rap1b) GTP-binding proteins [BR:cge04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     100769542 (Rap1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  100769542 NCBI-ProteinID:  XP_027248134 UniProt:  G3GY22 LinkDB All DBs Position 1 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataagctagtcgttcttggctccgggggtgttggaaagtcggctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacaatagaagactcatat agaaagcaagttgaagtagatgcgcagcagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagagatttgtacatgaagaatgggcagggctttgctttg gtttactccatcacagcacagtctacatttaatgatttacaagatctgagagagcagatt cttcgggttaaagacactgatgatgttccaatgattctggttggtaataaatgtgacttg gaagatgaaagagttgtagggaaggaacaaggtcaaaacctagcaagacaatggaacaac tgtgcattcttagagtcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system