Cricetulus griseus (Chinese hamster): 100773244 Help Entry 100773244         CDS       T02813                                  Name (RefSeq) CD209 antigen-like protein D   KO K06563   C-type lectin domain family 4 member L/M Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge03260   Virion - Human immunodeficiency virus cge03264   Virion - Flavivirus and Alphavirus cge03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus cge03273   Virion - Lassa virus and SFTS virus cge04145   Phagocytosis cge04517   IgSF CAM signaling cge04625   C-type lectin receptor signaling pathway cge05152   Tuberculosis cge05162   Measles Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     100773244    03264 Virion - Flavivirus and Alphavirus     100773244    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     100773244    03273 Virion - Lassa virus and SFTS virus     100773244  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100773244  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     100773244  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100773244  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     100773244   09171 Infectious disease: bacterial    05152 Tuberculosis     100773244  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cge04131]     100773244   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:cge04054]     100773244    04515 Cell adhesion molecules [BR:cge04515]     100773244    04090 CD molecules [BR:cge04090]     100773244    04091 Lectins [BR:cge04091]     100773244 Membrane trafficking [BR:cge04131]  Endocytosis   Phagocytosis    C-lectin receptors     100773244 Pattern recognition receptors [BR:cge04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    100773244 Cell adhesion molecules [BR:cge04515]  Lectins   Selectins and C-type lectins    100773244 CD molecules [BR:cge04090]  Proteins   100773244 Lectins [BR:cge04091]  C-Type lectins   Asialoglycoprotein and DC receptors    100773244 SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C HERV-K_REC Motif Other DBs NCBI-GeneID:  100773244 NCBI-ProteinID:  XP_035300258 UniProt:  A0A9J7H0S1 LinkDB All DBs Position 4 Genome browser AA seq 178 aa AA seqDB search MSDTTEPRLQQLGTLVSKVPSSQVQDKIYQELMQLKIDVHDGLCQPCPRDWTFFHGNCYF FSKSQRNWHNSVTACQEVGAQLVIVETDEEQTFLQQTSKAKGPTWMGLSDMHNEATWHWV DGSTLSPSFEQYWNKGEPNNVGDEDCAEFSKDGWNDLKCDSLNFWICKKASTSSCTTK NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccacagaaccaaggctacagcaactgggcactctggtctcaaaggtcccc agctcccaggttcaggacaaaatctaccaggagctcatgcagctgaagattgacgtgcat gatggattgtgtcaaccctgccccagggactggacgttcttccatggaaactgttacttc ttctccaagtcccaacggaactggcacaactccgtcactgcctgccaggaggtgggagcc cagctggtcattgtagagactgatgaggagcagaccttcctgcagcagacttctaaggct aaaggaccaacttggatggggctgtcagacatgcataatgaagccacgtggcactgggtg gatggctcaactctgtcacccagctttgagcagtattggaataaaggggaacccaacaat gtcggagacgaagattgtgcagagttctctaaggatggctggaatgatctcaaatgtgat tccctgaatttctggatctgtaagaaagcctcaacctcatcatgcaccaccaagtga

DBGET integrated database retrieval system