Cricetulus griseus (Chinese hamster): 100774680 Help Entry 100774680         CDS       T02813                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge00510   N-Glycan biosynthesis cge00513   Various types of N-glycan biosynthesis cge04141   Protein processing in endoplasmic reticulum Module cge_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cge00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100774680    00513 Various types of N-glycan biosynthesis     100774680  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100774680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  100774680 NCBI-ProteinID:  XP_027259412 UniProt:  G3HME0 LinkDB All DBs Position 2:99281295..99282049 Genome browser AA seq 80 aa AA seqDB search MELEEAMSWYTSLVNLAVFPHLTMVLLAIGMLFTTWLLIYEVITIKHTCNIYKELLIFLL ASLFMGFGVLFLLLWIGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggaggccatgagttggtacactagcctggtcaatctggctgtcttccca cacctgactatggtacttctggccatcggcatgttattcaccacctggttgttgatttat gaggtcataaccatcaagcacacatgcaatatttacaaagagctcctcatcttcttgctg gcctcactcttcatgggctttggagtcctcttcctcctgctctggattggcatctatgta tga

DBGET integrated database retrieval system