Cricetulus griseus (Chinese hamster): 113830633 Help Entry 113830633         CDS       T02813                                  Symbol Actg1 Name (RefSeq) actin, cytoplasmic 2 isoform X2   KO K05692   actin beta/gamma 1 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge03082   ATP-dependent chromatin remodeling cge04015   Rap1 signaling pathway cge04145   Phagosome cge04210   Apoptosis cge04390   Hippo signaling pathway cge04510   Focal adhesion cge04517   IgSF CAM signaling cge04518   Integrin signaling cge04519   Cadherin signaling cge04520   Adherens junction cge04530   Tight junction cge04611   Platelet activation cge04613   Neutrophil extracellular trap formation cge04670   Leukocyte transendothelial migration cge04714   Thermogenesis cge04810   Regulation of actin cytoskeleton cge04814   Motor proteins cge04820   Cytoskeleton in muscle cells cge04919   Thyroid hormone signaling pathway cge04921   Oxytocin signaling pathway cge04971   Gastric acid secretion cge05014   Amyotrophic lateral sclerosis cge05100   Bacterial invasion of epithelial cells cge05132   Salmonella infection cge05135   Yersinia infection cge05164   Influenza A cge05205   Proteoglycans in cancer cge05225   Hepatocellular carcinoma cge05410   Hypertrophic cardiomyopathy cge05412   Arrhythmogenic right ventricular cardiomyopathy cge05414   Dilated cardiomyopathy cge05416   Viral myocarditis cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113830633 (Actg1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     113830633 (Actg1)    04390 Hippo signaling pathway     113830633 (Actg1)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113830633 (Actg1)    04518 Integrin signaling     113830633 (Actg1)    04519 Cadherin signaling     113830633 (Actg1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113830633 (Actg1)   09143 Cell growth and death    04210 Apoptosis     113830633 (Actg1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     113830633 (Actg1)    04520 Adherens junction     113830633 (Actg1)    04530 Tight junction     113830633 (Actg1)   09142 Cell motility    04814 Motor proteins     113830633 (Actg1)    04820 Cytoskeleton in muscle cells     113830633 (Actg1)    04810 Regulation of actin cytoskeleton     113830633 (Actg1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     113830633 (Actg1)    04613 Neutrophil extracellular trap formation     113830633 (Actg1)    04670 Leukocyte transendothelial migration     113830633 (Actg1)   09152 Endocrine system    04921 Oxytocin signaling pathway     113830633 (Actg1)    04919 Thyroid hormone signaling pathway     113830633 (Actg1)   09154 Digestive system    04971 Gastric acid secretion     113830633 (Actg1)   09159 Environmental adaptation    04714 Thermogenesis     113830633 (Actg1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     113830633 (Actg1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     113830633 (Actg1)   09172 Infectious disease: viral    05164 Influenza A     113830633 (Actg1)   09171 Infectious disease: bacterial    05132 Salmonella infection     113830633 (Actg1)    05135 Yersinia infection     113830633 (Actg1)    05100 Bacterial invasion of epithelial cells     113830633 (Actg1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     113830633 (Actg1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     113830633 (Actg1)    05410 Hypertrophic cardiomyopathy     113830633 (Actg1)    05412 Arrhythmogenic right ventricular cardiomyopathy     113830633 (Actg1)    05414 Dilated cardiomyopathy     113830633 (Actg1)    05416 Viral myocarditis     113830633 (Actg1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cge03021]     113830633 (Actg1)    03019 Messenger RNA biogenesis [BR:cge03019]     113830633 (Actg1)    03036 Chromosome and associated proteins [BR:cge03036]     113830633 (Actg1)    03029 Mitochondrial biogenesis [BR:cge03029]     113830633 (Actg1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cge04812]     113830633 (Actg1)    04147 Exosome [BR:cge04147]     113830633 (Actg1) Transcription machinery [BR:cge03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      113830633 (Actg1) Messenger RNA biogenesis [BR:cge03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      113830633 (Actg1) Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      113830633 (Actg1)     NuA4 complex      113830633 (Actg1)   Chromatin remodeling factors    BAF complex     113830633 (Actg1)    PBAF complex     113830633 (Actg1)    GBAF(ncBAF) complex     113830633 (Actg1)    SWR1 complex     113830633 (Actg1) Mitochondrial biogenesis [BR:cge03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     113830633 (Actg1) Cytoskeleton proteins [BR:cge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      113830633 (Actg1) Exosome [BR:cge04147]  Exosomal proteins   Proteins found in most exosomes    113830633 (Actg1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin DUF6581 Motif Other DBs NCBI-GeneID:  113830633 NCBI-ProteinID:  XP_035303412 UniProt:  A0A8C2MH88 LinkDB All DBs Position 7:complement(132839572..132842403) Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaatcgccgcgctcgtcattgacaatggctccggcatgtgcaaagctggc tttgctggcgacgacgcccccagggccgtgttcccttccatcgtcgggcgcccccggcac cagggcgtcatggtgggcatgggccagaaggactcgtacgtgggtgacgaggcccagagc aagagaggcatcctgaccctgaagtaccccatcgagcacggcattgtcaccaactgggat gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgaggag caccccgtgctcctgaccgaggcccccctgaaccccaaagcgaacagagagaagatgacg cagataatgtttgagaccttcaataccccagccatgtacgtggccattcaggcggtgctg tccctgtatgcatccgggcgcaccactggcattgtcatggactctggtgacggggtcaca cacacagtgcccatctacgagggctacgcccttccccacgccatcttgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctgactgagaggggctacagcttc accaccacggctgagcgggaaattgtgcgtgacattaaggagaagctgtgctatgttgcc ctggattttgagcaggaaatggctactgctgcatcctcctcctccttggagaagagctat gagctgcctgatgggcaggtgatcaccattggcaatgagcggttccggtgtccagaggcg ctcttccagccttccttcctgggcatggagtcgtgtggcatccacgagaccaccttcaac tccatcatgaagtgtgacgtggacatccgcaaagacctctatgccaacacggtgctgtct ggcggcaccaccatgtaccccggcattgctgacaggatgcagaaggagatcacagccctg gctcccagcacaatgaagattaagatcattgctccccctgagcgcaagtactccgtctgg attggcggctccatcctggcctcgctctccaccttccagcagatgtggatcagcaagcag gagtacgacgagtcaggcccctccatcgtgcaccgcaaatgcttctag

DBGET integrated database retrieval system