Carassius gibelio (silver crucian carp): 127947484 Help Entry 127947484         CDS       T08819                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib00510   N-Glycan biosynthesis cgib00513   Various types of N-glycan biosynthesis cgib04141   Protein processing in endoplasmic reticulum Module cgib_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cgib00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     127947484    00513 Various types of N-glycan biosynthesis     127947484  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127947484 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  127947484 NCBI-ProteinID:  XP_052400602 LinkDB All DBs Position A25:complement(1708648..1711479) Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLMAIGMFFTAWFFVYEVTSTKYTRDLYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaagccatgactagatacaccagtccagtgaaccctgcagtgtttcctcac ctcactgtagtactgatggccatcggcatgttcttcaccgcctggttctttgtatatgaa gtgacgtccacgaagtacacgcgagatctgtacaaagagctgctgatttctctggtggct tcgctcttcatgggcttcggcgttctgttcctcttactgtgggtcggcatttatgtctga

DBGET integrated database retrieval system