Cotesia glomerata: 123260727 Help Entry 123260727         CDS       T07738                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism cglo  Cotesia glomerata Pathway cglo00510   N-Glycan biosynthesis cglo00513   Various types of N-glycan biosynthesis cglo04141   Protein processing in endoplasmic reticulum Module cglo_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cglo00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     123260727    00513 Various types of N-glycan biosynthesis     123260727  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123260727 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Pox_E2-like Motif Other DBs NCBI-GeneID:  123260727 NCBI-ProteinID:  XP_044577934 LinkDB All DBs Position LG3:20302003..20302932 Genome browser AA seq 80 aa AA seqDB search MIEIESMARYVSPINPTIFPVLALVLLGIGIFFTAWFFVYEVTSTKFTRDIYKELLVSLV AALFSGFGVLFLMLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgattgaaattgaatcaatggcaaggtatgtctcaccaatcaatccaacgatattccca gtgttagcacttgttttacttggaattgggatttttttcactgcttggtttttcgtctac gaagtaaccagtacaaaattcactagagatatttataaagaactattagtgtctcttgtt gctgcattattttctggttttggagtccttttcttaatgctgtgggtcggaatttacgta taa

DBGET integrated database retrieval system